Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   NCY29_RS06085 Genome accession   NZ_CP098411
Coordinates   1270375..1270860 (+) Length   161 a.a.
NCBI ID   WP_016375453.1    Uniprot ID   -
Organism   Lacticaseibacillus paracasei strain 401     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1258180..1305545 1270375..1270860 within 0


Gene organization within MGE regions


Location: 1258180..1305545
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NCY29_RS05985 (NCY29_05985) - 1258180..1259364 (-) 1185 WP_250786093.1 tyrosine-type recombinase/integrase -
  NCY29_RS05990 (NCY29_05990) - 1259571..1261187 (-) 1617 WP_216501221.1 SIR2 family protein -
  NCY29_RS05995 (NCY29_05995) - 1261264..1261467 (-) 204 WP_064656593.1 hypothetical protein -
  NCY29_RS06000 (NCY29_06000) - 1261491..1261916 (-) 426 WP_250786094.1 pyridoxamine 5'-phosphate oxidase family protein -
  NCY29_RS06005 (NCY29_06005) - 1262177..1262563 (-) 387 WP_250786095.1 DUF2513 domain-containing protein -
  NCY29_RS06010 (NCY29_06010) - 1262581..1263423 (-) 843 WP_250786096.1 hypothetical protein -
  NCY29_RS06015 (NCY29_06015) - 1263501..1264202 (-) 702 WP_003574520.1 DUF3862 domain-containing protein -
  NCY29_RS06020 (NCY29_06020) - 1264266..1264685 (-) 420 WP_250786097.1 ImmA/IrrE family metallo-endopeptidase -
  NCY29_RS06025 (NCY29_06025) - 1264675..1265010 (-) 336 WP_005714743.1 helix-turn-helix transcriptional regulator -
  NCY29_RS06030 (NCY29_06030) - 1265148..1265390 (+) 243 WP_003595437.1 helix-turn-helix transcriptional regulator -
  NCY29_RS06035 (NCY29_06035) - 1265387..1265698 (+) 312 WP_003574526.1 hypothetical protein -
  NCY29_RS06040 (NCY29_06040) - 1265695..1265904 (-) 210 WP_250786098.1 hypothetical protein -
  NCY29_RS06045 (NCY29_06045) - 1265992..1266138 (+) 147 WP_003594175.1 hypothetical protein -
  NCY29_RS06050 (NCY29_06050) - 1266204..1266752 (+) 549 WP_003582311.1 hypothetical protein -
  NCY29_RS06055 (NCY29_06055) - 1266731..1266952 (+) 222 WP_016373290.1 helix-turn-helix domain-containing protein -
  NCY29_RS14960 - 1266965..1267093 (+) 129 WP_003581996.1 hypothetical protein -
  NCY29_RS06060 (NCY29_06060) - 1267081..1267323 (+) 243 WP_250786099.1 hypothetical protein -
  NCY29_RS06065 (NCY29_06065) - 1267325..1267495 (+) 171 WP_080772331.1 hypothetical protein -
  NCY29_RS06070 (NCY29_06070) - 1267509..1268405 (+) 897 WP_250786100.1 DUF1351 domain-containing protein -
  NCY29_RS06075 (NCY29_06075) - 1268408..1269334 (+) 927 WP_238065089.1 hypothetical protein -
  NCY29_RS06080 (NCY29_06080) - 1269409..1270362 (+) 954 WP_250786101.1 DnaD domain protein -
  NCY29_RS06085 (NCY29_06085) ssb 1270375..1270860 (+) 486 WP_016375453.1 single-stranded DNA-binding protein Machinery gene
  NCY29_RS06090 (NCY29_06090) - 1270876..1271325 (+) 450 WP_202960067.1 hypothetical protein -
  NCY29_RS06095 (NCY29_06095) - 1271328..1271711 (+) 384 WP_250786102.1 DUF1064 domain-containing protein -
  NCY29_RS06100 (NCY29_06100) - 1271730..1272194 (+) 465 WP_003574547.1 hypothetical protein -
  NCY29_RS06105 (NCY29_06105) - 1272206..1272355 (+) 150 WP_003574549.1 hypothetical protein -
  NCY29_RS06110 (NCY29_06110) - 1272327..1272875 (+) 549 WP_003574551.1 DUF1642 domain-containing protein -
  NCY29_RS06115 (NCY29_06115) - 1273055..1273456 (+) 402 WP_250786103.1 DUF1642 domain-containing protein -
  NCY29_RS06120 (NCY29_06120) - 1273453..1273692 (+) 240 WP_014569479.1 hypothetical protein -
  NCY29_RS06125 (NCY29_06125) - 1273689..1273898 (+) 210 WP_250786104.1 hypothetical protein -
  NCY29_RS06130 (NCY29_06130) - 1273935..1274222 (+) 288 WP_250786105.1 hypothetical protein -
  NCY29_RS06135 (NCY29_06135) - 1274506..1274958 (+) 453 WP_016373304.1 ArpU family phage packaging/lysis transcriptional regulator -
  NCY29_RS06140 (NCY29_06140) - 1275382..1276395 (+) 1014 WP_250786106.1 hypothetical protein -
  NCY29_RS06145 (NCY29_06145) - 1277621..1278769 (+) 1149 WP_123018489.1 GcrA family cell cycle regulator -
  NCY29_RS14965 - 1278952..1279086 (+) 135 WP_011674655.1 hypothetical protein -
  NCY29_RS06150 (NCY29_06150) - 1279155..1279727 (+) 573 WP_011674654.1 terminase small subunit -
  NCY29_RS06155 (NCY29_06155) - 1279711..1280964 (+) 1254 WP_076653661.1 PBSX family phage terminase large subunit -
  NCY29_RS06160 (NCY29_06160) - 1280969..1282396 (+) 1428 WP_123018490.1 phage portal protein -
  NCY29_RS06165 (NCY29_06165) - 1282362..1283354 (+) 993 WP_250786107.1 minor capsid protein -
  NCY29_RS06170 (NCY29_06170) - 1283479..1284135 (+) 657 WP_076652115.1 DUF4355 domain-containing protein -
  NCY29_RS06175 (NCY29_06175) - 1284151..1285164 (+) 1014 WP_016373309.1 hypothetical protein -
  NCY29_RS06180 (NCY29_06180) - 1285179..1285430 (+) 252 WP_076652116.1 Ig-like domain-containing protein -
  NCY29_RS06185 (NCY29_06185) - 1285501..1285875 (+) 375 WP_076652118.1 phage head-tail connector protein -
  NCY29_RS06190 (NCY29_06190) - 1285880..1286182 (+) 303 WP_076652120.1 hypothetical protein -
  NCY29_RS06195 (NCY29_06195) - 1286179..1286544 (+) 366 WP_076652121.1 HK97-gp10 family putative phage morphogenesis protein -
  NCY29_RS06200 (NCY29_06200) - 1286545..1286949 (+) 405 WP_076652123.1 DUF3168 domain-containing protein -
  NCY29_RS06205 (NCY29_06205) - 1286961..1287563 (+) 603 WP_250786108.1 phage tail tube protein -
  NCY29_RS06210 (NCY29_06210) - 1287649..1287981 (+) 333 WP_076652126.1 tail assembly chaperone -
  NCY29_RS06215 (NCY29_06215) - 1288086..1288439 (+) 354 WP_076652129.1 hypothetical protein -
  NCY29_RS06220 (NCY29_06220) - 1288432..1291521 (+) 3090 WP_076652128.1 tape measure protein -
  NCY29_RS06225 (NCY29_06225) - 1291524..1293491 (+) 1968 WP_250786109.1 distal tail protein Dit -
  NCY29_RS06230 (NCY29_06230) - 1293488..1296004 (+) 2517 WP_250786110.1 phage tail protein -
  NCY29_RS06235 (NCY29_06235) - 1296004..1296294 (+) 291 WP_076652325.1 hypothetical protein -
  NCY29_RS06240 (NCY29_06240) - 1296287..1296418 (+) 132 WP_123157036.1 XkdX family protein -
  NCY29_RS06245 (NCY29_06245) - 1296450..1296749 (+) 300 WP_250786111.1 hypothetical protein -
  NCY29_RS06250 (NCY29_06250) - 1296764..1297069 (+) 306 Protein_1217 phage holin -
  NCY29_RS06255 (NCY29_06255) - 1297352..1297558 (+) 207 WP_032800986.1 hypothetical protein -
  NCY29_RS06260 (NCY29_06260) - 1297576..1298751 (+) 1176 WP_250786112.1 GH25 family lysozyme -
  NCY29_RS15020 - 1298949..1299023 (+) 75 Protein_1220 glucose-6-phosphate isomerase -
  NCY29_RS06265 (NCY29_06265) - 1299382..1300165 (-) 784 Protein_1221 DUF1828 domain-containing protein -
  NCY29_RS06270 (NCY29_06270) - 1300267..1300554 (-) 288 WP_003564892.1 putative quinol monooxygenase -
  NCY29_RS06275 (NCY29_06275) - 1300737..1301267 (-) 531 WP_016384443.1 hypothetical protein -
  NCY29_RS06280 (NCY29_06280) - 1301348..1302199 (-) 852 WP_250786113.1 DNA/RNA non-specific endonuclease -
  NCY29_RS06285 (NCY29_06285) - 1302196..1302942 (-) 747 WP_063557786.1 hypothetical protein -
  NCY29_RS06290 (NCY29_06290) - 1303078..1304241 (-) 1164 WP_003587712.1 glycosyltransferase -
  NCY29_RS06295 (NCY29_06295) - 1304628..1305545 (+) 918 WP_003661200.1 Gfo/Idh/MocA family oxidoreductase -

Sequence


Protein


Download         Length: 161 a.a.        Molecular weight: 17591.39 Da        Isoelectric Point: 9.5253

>NTDB_id=695320 NCY29_RS06085 WP_016375453.1 1270375..1270860(+) (ssb) [Lacticaseibacillus paracasei strain 401]
MLNSVSLTGRLTRDVDLRYTQSGTAVGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAANFANFTKKGSLVGVEGRIQTR
TYDNAQGQKVFVTEVIVDSFALLESRQAYQNNPKSQQAANASATATTNASQTNPNASRANTTDPFANNGKPLDISDDDLP
F

Nucleotide


Download         Length: 486 bp        

>NTDB_id=695320 NCY29_RS06085 WP_016375453.1 1270375..1270860(+) (ssb) [Lacticaseibacillus paracasei strain 401]
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTAACAAGAGATGTTGATTTGCGCTACACACAAAGCGGCACGGCTGTCGG
TTCGTTCACACTGGCAGTTGATCGCAAATTCAAGAGCAAAAACGGAGAACGAGAAACTGATTTCGTAAATTGCCAGATCT
GGCGCAAGTCGGCTGCGAACTTTGCAAACTTCACCAAAAAAGGATCCTTGGTTGGTGTGGAAGGCCGTATTCAAACGCGT
ACGTATGATAACGCGCAAGGGCAGAAAGTGTTCGTGACTGAGGTAATCGTTGATAGCTTTGCTTTGCTTGAGTCACGACA
GGCGTATCAGAACAACCCTAAATCGCAGCAAGCGGCCAATGCATCAGCAACGGCGACCACAAACGCGAGTCAAACGAATC
CAAATGCTTCGCGAGCGAACACCACGGATCCGTTTGCCAATAATGGCAAGCCGCTCGACATTTCCGATGATGATTTGCCA
TTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

61.176

100

0.646

  ssbA Bacillus subtilis subsp. subtilis str. 168

51.744

100

0.553

  ssbB Bacillus subtilis subsp. subtilis str. 168

55.66

65.839

0.366