Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   NBY72_RS12725 Genome accession   NZ_CP098036
Coordinates   2369749..2369922 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SPC-17-3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2364749..2374922
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NBY72_RS12710 (NBY72_12710) gcvT 2365548..2366636 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  NBY72_RS12715 (NBY72_12715) hepAA 2367078..2368751 (+) 1674 WP_014480248.1 SNF2-related protein -
  NBY72_RS12720 (NBY72_12720) yqhG 2368772..2369566 (+) 795 WP_014480249.1 YqhG family protein -
  NBY72_RS12725 (NBY72_12725) sinI 2369749..2369922 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NBY72_RS12730 (NBY72_12730) sinR 2369956..2370291 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NBY72_RS12735 (NBY72_12735) tasA 2370384..2371169 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  NBY72_RS12740 (NBY72_12740) sipW 2371233..2371805 (-) 573 WP_003230181.1 signal peptidase I SipW -
  NBY72_RS12745 (NBY72_12745) tapA 2371789..2372550 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  NBY72_RS12750 (NBY72_12750) yqzG 2372822..2373148 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NBY72_RS12755 (NBY72_12755) spoIITA 2373190..2373369 (-) 180 WP_014480252.1 YqzE family protein -
  NBY72_RS12760 (NBY72_12760) comGG 2373440..2373814 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NBY72_RS12765 (NBY72_12765) comGF 2373815..2374198 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  NBY72_RS12770 (NBY72_12770) comGE 2374224..2374571 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=693753 NBY72_RS12725 WP_003230187.1 2369749..2369922(+) (sinI) [Bacillus subtilis strain SPC-17-3]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=693753 NBY72_RS12725 WP_003230187.1 2369749..2369922(+) (sinI) [Bacillus subtilis strain SPC-17-3]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1