Detailed information
Bioinformatically predicted
Overview
| Name | pilV | Type | Machinery gene |
| Locus tag | M8779_RS02765 | Genome accession | NZ_CP097846 |
| Coordinates | 526221..526832 (+) | Length | 203 a.a. |
| NCBI ID | WP_050169631.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain AT159 | ||
| Function | repress natural transformation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 523963..579767 | 526221..526832 | within | 0 |
Gene organization within MGE regions
Location: 523963..579767
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8779_RS02755 (M8779_02750) | dnaB | 523963..525369 (+) | 1407 | WP_047917169.1 | replicative DNA helicase | - |
| M8779_RS02760 (M8779_02755) | pilH | 525524..526189 (+) | 666 | WP_047918678.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| M8779_RS02765 (M8779_02760) | pilV | 526221..526832 (+) | 612 | WP_050169631.1 | type IV pilus modification protein PilV | Machinery gene |
| M8779_RS02770 (M8779_02765) | pilJ | 526829..527809 (+) | 981 | WP_010951046.1 | PilW family protein | Machinery gene |
| M8779_RS02775 (M8779_02770) | pilK | 527788..528399 (+) | 612 | WP_003687918.1 | pilus assembly protein | Machinery gene |
| M8779_RS02780 (M8779_02775) | pilL | 528401..528874 (+) | 474 | WP_025455870.1 | PilX family type IV pilin | Machinery gene |
| M8779_RS02785 (M8779_02780) | - | 528944..529252 (-) | 309 | WP_003706588.1 | AzlD family protein | - |
| M8779_RS02790 (M8779_02785) | - | 529249..529958 (-) | 710 | Protein_542 | AzlC family ABC transporter permease | - |
| M8779_RS02795 (M8779_02790) | dut | 530124..530576 (+) | 453 | WP_003702446.1 | dUTP diphosphatase | - |
| M8779_RS02800 (M8779_02795) | dapC | 530654..531841 (+) | 1188 | WP_003690911.1 | succinyldiaminopimelate transaminase | - |
| M8779_RS02805 (M8779_02800) | yaaA | 531997..532776 (+) | 780 | WP_003690913.1 | peroxide stress protein YaaA | - |
| M8779_RS02820 (M8779_02815) | - | 533307..534503 (+) | 1197 | WP_017147117.1 | integrase arm-type DNA-binding domain-containing protein | - |
| M8779_RS02825 (M8779_02820) | - | 534859..535128 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| M8779_RS02830 (M8779_02825) | - | 535323..536006 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| M8779_RS12190 | - | 536320..536553 (-) | 234 | Protein_549 | hypothetical protein | - |
| M8779_RS02840 (M8779_02835) | - | 536664..536879 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| M8779_RS02845 (M8779_02840) | - | 536931..537422 (-) | 492 | WP_017147227.1 | siphovirus Gp157 family protein | - |
| M8779_RS02850 (M8779_02845) | - | 537419..537601 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| M8779_RS02855 (M8779_02850) | - | 537741..538427 (-) | 687 | WP_010951053.1 | hypothetical protein | - |
| M8779_RS02860 (M8779_02855) | - | 538496..538657 (-) | 162 | WP_003702497.1 | hypothetical protein | - |
| M8779_RS02865 (M8779_02860) | - | 538654..538932 (-) | 279 | WP_003691529.1 | hypothetical protein | - |
| M8779_RS02870 (M8779_02865) | - | 539085..539417 (-) | 333 | WP_003687946.1 | hypothetical protein | - |
| M8779_RS02875 (M8779_02870) | - | 539558..539845 (-) | 288 | WP_252295574.1 | hypothetical protein | - |
| M8779_RS02880 (M8779_02875) | - | 539842..540318 (-) | 477 | WP_012504141.1 | hypothetical protein | - |
| M8779_RS02885 (M8779_02880) | - | 540351..540551 (-) | 201 | WP_047917349.1 | hypothetical protein | - |
| M8779_RS02890 (M8779_02885) | - | 540749..541162 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| M8779_RS02895 (M8779_02890) | - | 541159..541620 (-) | 462 | WP_003687965.1 | helix-turn-helix transcriptional regulator | - |
| M8779_RS02900 (M8779_02895) | - | 541637..542074 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| M8779_RS02905 (M8779_02900) | - | 542189..542905 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| M8779_RS02910 (M8779_02905) | - | 542974..543210 (+) | 237 | WP_003687971.1 | Cro/CI family transcriptional regulator | - |
| M8779_RS02915 (M8779_02910) | - | 543290..543445 (+) | 156 | WP_047923772.1 | hypothetical protein | - |
| M8779_RS02920 (M8779_02915) | - | 543422..543610 (-) | 189 | WP_047926773.1 | hypothetical protein | - |
| M8779_RS02925 (M8779_02920) | - | 543784..544011 (+) | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| M8779_RS02930 (M8779_02925) | - | 544008..545018 (+) | 1011 | WP_218422915.1 | helix-turn-helix domain-containing protein | - |
| M8779_RS02935 (M8779_02930) | - | 545033..545815 (+) | 783 | WP_025456432.1 | ATP-binding protein | - |
| M8779_RS02940 (M8779_02935) | - | 545885..546091 (+) | 207 | WP_184982621.1 | hypothetical protein | - |
| M8779_RS02945 (M8779_02940) | - | 546130..546624 (+) | 495 | WP_041421248.1 | DUF3310 domain-containing protein | - |
| M8779_RS02950 (M8779_02945) | - | 546801..546950 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| M8779_RS02955 (M8779_02950) | - | 546979..547260 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| M8779_RS02960 (M8779_02955) | - | 547251..547631 (+) | 381 | WP_033910829.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M8779_RS12060 | - | 547648..547776 (-) | 129 | WP_256263200.1 | hypothetical protein | - |
| M8779_RS02965 (M8779_02960) | - | 547898..548305 (+) | 408 | WP_047922557.1 | hypothetical protein | - |
| M8779_RS02970 (M8779_02965) | - | 548366..549325 (+) | 960 | WP_123768253.1 | hypothetical protein | - |
| M8779_RS02975 (M8779_02970) | - | 549607..550476 (+) | 870 | WP_033910830.1 | BRO family protein | - |
| M8779_RS02980 (M8779_02975) | - | 550769..551218 (+) | 450 | WP_003695485.1 | hypothetical protein | - |
| M8779_RS02985 (M8779_02980) | terL | 551280..552701 (+) | 1422 | WP_003697216.1 | phage terminase large subunit | - |
| M8779_RS02990 (M8779_02985) | - | 552698..554845 (+) | 2148 | WP_003691423.1 | phage portal protein | - |
| M8779_RS02995 (M8779_02990) | - | 554913..556070 (+) | 1158 | WP_010360058.1 | HK97 family phage prohead protease | - |
| M8779_RS03000 (M8779_02995) | - | 556112..557611 (+) | 1500 | WP_003689084.1 | hypothetical protein | - |
| M8779_RS03005 (M8779_03000) | - | 557618..558010 (+) | 393 | WP_123771580.1 | hypothetical protein | - |
| M8779_RS03010 (M8779_03005) | - | 558013..558543 (+) | 531 | WP_003689080.1 | head-tail connector protein | - |
| M8779_RS03015 (M8779_03010) | - | 558543..559025 (+) | 483 | WP_003703855.1 | HK97 gp10 family phage protein | - |
| M8779_RS03020 (M8779_03015) | - | 559022..559450 (+) | 429 | WP_003689076.1 | hypothetical protein | - |
| M8779_RS03025 (M8779_03020) | - | 559476..560249 (+) | 774 | WP_003691416.1 | hypothetical protein | - |
| M8779_RS03030 (M8779_03025) | - | 560310..560639 (+) | 330 | WP_003692871.1 | hypothetical protein | - |
| M8779_RS03035 (M8779_03030) | - | 560651..560917 (+) | 267 | WP_003689070.1 | hypothetical protein | - |
| M8779_RS03040 (M8779_03035) | - | 560917..561516 (+) | 600 | WP_003692874.1 | DUF2460 domain-containing protein | - |
| M8779_RS03045 (M8779_03040) | - | 561513..562367 (+) | 855 | WP_003698614.1 | DUF2163 domain-containing protein | - |
| M8779_RS03050 (M8779_03045) | - | 562369..562800 (+) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| M8779_RS03055 (M8779_03050) | - | 562828..563106 (-) | 279 | WP_003689062.1 | XRE family transcriptional regulator | - |
| M8779_RS03060 (M8779_03055) | - | 563346..567491 (+) | 4146 | WP_252295678.1 | phage tail protein | - |
| M8779_RS03065 (M8779_03060) | - | 567603..567908 (+) | 306 | WP_003689058.1 | hypothetical protein | - |
| M8779_RS03070 (M8779_03065) | - | 567979..568449 (+) | 471 | WP_003691410.1 | hypothetical protein | - |
| M8779_RS03075 (M8779_03070) | - | 568450..568782 (+) | 333 | WP_003691408.1 | hypothetical protein | - |
| M8779_RS03080 (M8779_03075) | - | 569150..569497 (-) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| M8779_RS03085 (M8779_03080) | - | 569497..569733 (-) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| M8779_RS03090 (M8779_03085) | - | 569940..570479 (+) | 540 | WP_050163081.1 | TIGR02594 family protein | - |
| M8779_RS03095 (M8779_03090) | - | 570480..570824 (+) | 345 | WP_003695464.1 | hypothetical protein | - |
| M8779_RS03100 (M8779_03095) | - | 570808..570981 (+) | 174 | WP_164823238.1 | hypothetical protein | - |
| M8779_RS03105 (M8779_03100) | - | 571296..571445 (+) | 150 | WP_003691402.1 | hypothetical protein | - |
| M8779_RS03110 (M8779_03105) | - | 571475..574522 (+) | 3048 | WP_252295680.1 | tape measure protein | - |
| M8779_RS03115 (M8779_03110) | - | 574582..575061 (-) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| M8779_RS03120 (M8779_03115) | - | 575403..576392 (-) | 990 | WP_003689040.1 | site-specific integrase | - |
| M8779_RS03125 (M8779_03120) | purM | 577081..578115 (+) | 1035 | WP_003691398.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| M8779_RS03130 (M8779_03125) | - | 578333..578638 (+) | 306 | WP_047953262.1 | hypothetical protein | - |
| M8779_RS03135 (M8779_03130) | - | 579114..579767 (+) | 654 | WP_252295682.1 | IS1595 family transposase | - |
Sequence
Protein
Download Length: 203 a.a. Molecular weight: 22076.13 Da Isoelectric Point: 4.8546
>NTDB_id=692980 M8779_RS02765 WP_050169631.1 526221..526832(+) (pilV) [Neisseria gonorrhoeae strain AT159]
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDLDSNKKN
YSLYMGKQTLSAVDGKFMLDAEKSKAQLAEEQLKRFSHELKNALPDAVAIHYAVCKDSSGDAPTLSDSGAFSSNCDNKAN
GDTLIKVLWVNDSAGDSDISRTNLEVSGDNIVYTYQARVGGRE
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDLDSNKKN
YSLYMGKQTLSAVDGKFMLDAEKSKAQLAEEQLKRFSHELKNALPDAVAIHYAVCKDSSGDAPTLSDSGAFSSNCDNKAN
GDTLIKVLWVNDSAGDSDISRTNLEVSGDNIVYTYQARVGGRE
Nucleotide
Download Length: 612 bp
>NTDB_id=692980 M8779_RS02765 WP_050169631.1 526221..526832(+) (pilV) [Neisseria gonorrhoeae strain AT159]
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGTTGATAGAAGTCTTGGTCGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTACAGTTGCGGACAGTCGCTTCCGTCAGGGAGGCGGAAACGCAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTTGGACAGCAACAAGAAAAAC
TATAGTCTTTACATGGGAAAACAGACACTATCAGCTGTGGATGGTAAGTTTATGCTTGATGCCGAGAAAAGTAAGGCGCA
GTTGGCAGAGGAACAATTGAAGAGATTTAGTCATGAGCTGAAAAATGCCTTGCCGGATGCGGTAGCTATTCATTACGCCG
TCTGCAAGGATTCGTCGGGTGACGCGCCGACATTGTCCGACAGCGGTGCTTTTTCTTCAAATTGCGACAATAAGGCAAAC
GGGGATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGAAGTGAG
CGGCGACAATATCGTATATACCTATCAGGCAAGGGTCGGAGGTCGTGAATGA
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGTTGATAGAAGTCTTGGTCGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTACAGTTGCGGACAGTCGCTTCCGTCAGGGAGGCGGAAACGCAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTTGGACAGCAACAAGAAAAAC
TATAGTCTTTACATGGGAAAACAGACACTATCAGCTGTGGATGGTAAGTTTATGCTTGATGCCGAGAAAAGTAAGGCGCA
GTTGGCAGAGGAACAATTGAAGAGATTTAGTCATGAGCTGAAAAATGCCTTGCCGGATGCGGTAGCTATTCATTACGCCG
TCTGCAAGGATTCGTCGGGTGACGCGCCGACATTGTCCGACAGCGGTGCTTTTTCTTCAAATTGCGACAATAAGGCAAAC
GGGGATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGAAGTGAG
CGGCGACAATATCGTATATACCTATCAGGCAAGGGTCGGAGGTCGTGAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilV | Neisseria meningitidis 8013 |
89.372 |
100 |
0.911 |
| pilI | Neisseria gonorrhoeae MS11 |
83.744 |
100 |
0.837 |
| pilV | Neisseria gonorrhoeae MS11 |
83.744 |
100 |
0.837 |