Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   MF621_RS11385 Genome accession   NZ_CP097779
Coordinates   2355982..2356296 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain R 4.6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2350982..2361296
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MF621_RS11340 (MF621_002259) sinI 2351665..2351838 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  MF621_RS11345 (MF621_002260) sinR 2351872..2352207 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MF621_RS11350 (MF621_002261) tasA 2352255..2353040 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  MF621_RS11355 (MF621_002262) sipW 2353104..2353688 (-) 585 WP_025852917.1 signal peptidase I SipW -
  MF621_RS11360 (MF621_002263) tapA 2353660..2354331 (-) 672 WP_025852919.1 amyloid fiber anchoring/assembly protein TapA -
  MF621_RS11365 (MF621_002264) - 2354590..2354919 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  MF621_RS11370 (MF621_002265) - 2354959..2355138 (-) 180 WP_003153093.1 YqzE family protein -
  MF621_RS11375 (MF621_002266) comGG 2355195..2355572 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  MF621_RS11380 (MF621_002267) comGF 2355573..2356073 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  MF621_RS11385 (MF621_002268) comGE 2355982..2356296 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  MF621_RS11390 (MF621_002269) comGD 2356280..2356717 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  MF621_RS11395 (MF621_002270) comGC 2356707..2356973 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  MF621_RS11400 (MF621_002271) comGB 2357020..2358057 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  MF621_RS11405 (MF621_002272) comGA 2358044..2359114 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  MF621_RS11410 (MF621_002273) - 2359306..2360256 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=692291 MF621_RS11385 WP_015388003.1 2355982..2356296(-) (comGE) [Bacillus velezensis strain R 4.6]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=692291 MF621_RS11385 WP_015388003.1 2355982..2356296(-) (comGE) [Bacillus velezensis strain R 4.6]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481