Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | MF621_RS11340 | Genome accession | NZ_CP097779 |
| Coordinates | 2351665..2351838 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain R 4.6 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2346665..2356838
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MF621_RS11325 (MF621_002256) | gcvT | 2347483..2348583 (-) | 1101 | WP_003153108.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| MF621_RS11330 (MF621_002257) | - | 2349006..2350676 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| MF621_RS11335 (MF621_002258) | - | 2350694..2351488 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| MF621_RS11340 (MF621_002259) | sinI | 2351665..2351838 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| MF621_RS11345 (MF621_002260) | sinR | 2351872..2352207 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| MF621_RS11350 (MF621_002261) | tasA | 2352255..2353040 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| MF621_RS11355 (MF621_002262) | sipW | 2353104..2353688 (-) | 585 | WP_025852917.1 | signal peptidase I SipW | - |
| MF621_RS11360 (MF621_002263) | tapA | 2353660..2354331 (-) | 672 | WP_025852919.1 | amyloid fiber anchoring/assembly protein TapA | - |
| MF621_RS11365 (MF621_002264) | - | 2354590..2354919 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| MF621_RS11370 (MF621_002265) | - | 2354959..2355138 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| MF621_RS11375 (MF621_002266) | comGG | 2355195..2355572 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| MF621_RS11380 (MF621_002267) | comGF | 2355573..2356073 (-) | 501 | WP_226565836.1 | competence type IV pilus minor pilin ComGF | - |
| MF621_RS11385 (MF621_002268) | comGE | 2355982..2356296 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| MF621_RS11390 (MF621_002269) | comGD | 2356280..2356717 (-) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=692288 MF621_RS11340 WP_003153105.1 2351665..2351838(+) (sinI) [Bacillus velezensis strain R 4.6]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=692288 MF621_RS11340 WP_003153105.1 2351665..2351838(+) (sinI) [Bacillus velezensis strain R 4.6]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |