Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   M8966_RS16320 Genome accession   NZ_CP097589
Coordinates   3300377..3300754 (+) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain UA0311     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3295377..3305754
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8966_RS16285 - 3295688..3296638 (+) 951 WP_007408319.1 magnesium transporter CorA family protein -
  M8966_RS16290 comGA 3296835..3297905 (+) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  M8966_RS16295 comGB 3297892..3298929 (+) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  M8966_RS16300 comGC 3298934..3299242 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  M8966_RS16305 comGD 3299232..3299669 (+) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  M8966_RS16310 comGE 3299653..3299967 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  M8966_RS16315 comGF 3299876..3300376 (+) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  M8966_RS16320 comGG 3300377..3300754 (+) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8966_RS16325 - 3300811..3300990 (+) 180 WP_003153093.1 YqzE family protein -
  M8966_RS16330 - 3301030..3301359 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  M8966_RS16335 tapA 3301618..3302289 (+) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  M8966_RS16340 - 3302261..3302845 (+) 585 WP_012117977.1 signal peptidase I -
  M8966_RS16345 - 3302910..3303695 (+) 786 WP_007408329.1 TasA family protein -
  M8966_RS16350 sinR 3303743..3304078 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8966_RS16355 sinI 3304112..3304285 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  M8966_RS16360 - 3304462..3305256 (-) 795 WP_012117976.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=690665 M8966_RS16320 WP_012117980.1 3300377..3300754(+) (comGG) [Bacillus velezensis strain UA0311]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=690665 M8966_RS16320 WP_012117980.1 3300377..3300754(+) (comGG) [Bacillus velezensis strain UA0311]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512