Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | M8966_RS16355 | Genome accession | NZ_CP097589 |
| Coordinates | 3304112..3304285 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain UA0311 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3299112..3309285
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8966_RS16305 | comGD | 3299232..3299669 (+) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| M8966_RS16310 | comGE | 3299653..3299967 (+) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| M8966_RS16315 | comGF | 3299876..3300376 (+) | 501 | WP_012117981.1 | competence type IV pilus minor pilin ComGF | - |
| M8966_RS16320 | comGG | 3300377..3300754 (+) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| M8966_RS16325 | - | 3300811..3300990 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| M8966_RS16330 | - | 3301030..3301359 (-) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| M8966_RS16335 | tapA | 3301618..3302289 (+) | 672 | WP_012117978.1 | amyloid fiber anchoring/assembly protein TapA | - |
| M8966_RS16340 | - | 3302261..3302845 (+) | 585 | WP_012117977.1 | signal peptidase I | - |
| M8966_RS16345 | - | 3302910..3303695 (+) | 786 | WP_007408329.1 | TasA family protein | - |
| M8966_RS16350 | sinR | 3303743..3304078 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| M8966_RS16355 | sinI | 3304112..3304285 (-) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| M8966_RS16360 | - | 3304462..3305256 (-) | 795 | WP_012117976.1 | YqhG family protein | - |
| M8966_RS16365 | - | 3305278..3306948 (-) | 1671 | WP_012117975.1 | SNF2-related protein | - |
| M8966_RS16370 | gcvT | 3307372..3308472 (+) | 1101 | WP_012117974.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=690667 M8966_RS16355 WP_003153105.1 3304112..3304285(-) (sinI) [Bacillus velezensis strain UA0311]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=690667 M8966_RS16355 WP_003153105.1 3304112..3304285(-) (sinI) [Bacillus velezensis strain UA0311]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |