Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   M8964_RS16145 Genome accession   NZ_CP097585
Coordinates   3244840..3245277 (+) Length   145 a.a.
NCBI ID   WP_012117983.1    Uniprot ID   -
Organism   Bacillus velezensis strain UA1365     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3239840..3250277
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8964_RS16120 - 3239849..3241150 (-) 1302 WP_012117986.1 hemolysin family protein -
  M8964_RS16125 - 3241296..3242246 (+) 951 WP_007408319.1 magnesium transporter CorA family protein -
  M8964_RS16130 comGA 3242443..3243513 (+) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  M8964_RS16135 comGB 3243500..3244537 (+) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  M8964_RS16140 comGC 3244542..3244850 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  M8964_RS16145 comGD 3244840..3245277 (+) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  M8964_RS16150 comGE 3245261..3245575 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  M8964_RS16155 comGF 3245484..3245984 (+) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  M8964_RS16160 comGG 3245985..3246362 (+) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8964_RS16165 - 3246419..3246598 (+) 180 WP_003153093.1 YqzE family protein -
  M8964_RS16170 - 3246638..3246967 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  M8964_RS16175 tapA 3247226..3247897 (+) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  M8964_RS16180 - 3247869..3248453 (+) 585 WP_012117977.1 signal peptidase I -
  M8964_RS16185 - 3248518..3249303 (+) 786 WP_007408329.1 TasA family protein -
  M8964_RS16190 sinR 3249351..3249686 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8964_RS16195 sinI 3249720..3249893 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16286.74 Da        Isoelectric Point: 10.2475

>NTDB_id=690442 M8964_RS16145 WP_012117983.1 3244840..3245277(+) (comGD) [Bacillus velezensis strain UA1365]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=690442 M8964_RS16145 WP_012117983.1 3244840..3245277(+) (comGD) [Bacillus velezensis strain UA1365]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACGGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572