Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   M8964_RS16195 Genome accession   NZ_CP097585
Coordinates   3249720..3249893 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain UA1365     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3244720..3254893
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8964_RS16145 comGD 3244840..3245277 (+) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  M8964_RS16150 comGE 3245261..3245575 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  M8964_RS16155 comGF 3245484..3245984 (+) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  M8964_RS16160 comGG 3245985..3246362 (+) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8964_RS16165 - 3246419..3246598 (+) 180 WP_003153093.1 YqzE family protein -
  M8964_RS16170 - 3246638..3246967 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  M8964_RS16175 tapA 3247226..3247897 (+) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  M8964_RS16180 - 3247869..3248453 (+) 585 WP_012117977.1 signal peptidase I -
  M8964_RS16185 - 3248518..3249303 (+) 786 WP_007408329.1 TasA family protein -
  M8964_RS16190 sinR 3249351..3249686 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8964_RS16195 sinI 3249720..3249893 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  M8964_RS16200 - 3250070..3250864 (-) 795 WP_012117976.1 YqhG family protein -
  M8964_RS16205 - 3250886..3252556 (-) 1671 WP_012117975.1 SNF2-related protein -
  M8964_RS16210 gcvT 3252980..3254080 (+) 1101 WP_012117974.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=690445 M8964_RS16195 WP_003153105.1 3249720..3249893(-) (sinI) [Bacillus velezensis strain UA1365]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=690445 M8964_RS16195 WP_003153105.1 3249720..3249893(-) (sinI) [Bacillus velezensis strain UA1365]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702