Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   M2904_RS06445 Genome accession   NZ_CP097053
Coordinates   1324747..1325265 (-) Length   172 a.a.
NCBI ID   WP_248852972.1    Uniprot ID   -
Organism   Vagococcus lutrae strain AT15     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1303828..1337023 1324747..1325265 within 0


Gene organization within MGE regions


Location: 1303828..1337023
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M2904_RS06320 (M2904_06320) - 1303828..1304853 (-) 1026 WP_248852122.1 N-acetylmuramoyl-L-alanine amidase -
  M2904_RS06325 (M2904_06325) - 1304858..1305124 (-) 267 WP_248848571.1 phage holin family protein -
  M2904_RS06330 (M2904_06330) - 1305130..1305471 (-) 342 WP_248848570.1 hypothetical protein -
  M2904_RS06335 (M2904_06335) - 1305634..1305954 (-) 321 WP_248852121.1 hypothetical protein -
  M2904_RS06340 (M2904_06340) - 1305948..1307918 (-) 1971 WP_248852966.1 DUF859 family phage minor structural protein -
  M2904_RS06345 (M2904_06345) - 1307919..1310927 (-) 3009 WP_248852967.1 phage tail spike protein -
  M2904_RS06350 (M2904_06350) - 1310927..1311583 (-) 657 WP_248848566.1 hypothetical protein -
  M2904_RS06355 (M2904_06355) - 1311587..1314181 (-) 2595 WP_248852968.1 hypothetical protein -
  M2904_RS06360 (M2904_06360) - 1314522..1314962 (-) 441 WP_248848564.1 hypothetical protein -
  M2904_RS06365 (M2904_06365) - 1314965..1315567 (-) 603 WP_248848563.1 hypothetical protein -
  M2904_RS06370 (M2904_06370) - 1315567..1315935 (-) 369 WP_248848562.1 hypothetical protein -
  M2904_RS06375 (M2904_06375) - 1315941..1316375 (-) 435 WP_248848561.1 HK97-gp10 family putative phage morphogenesis protein -
  M2904_RS06380 (M2904_06380) - 1316368..1316697 (-) 330 WP_248848560.1 head-tail adaptor protein -
  M2904_RS06385 (M2904_06385) - 1316697..1317230 (-) 534 WP_248848559.1 hypothetical protein -
  M2904_RS06390 (M2904_06390) - 1317257..1317529 (-) 273 WP_248848558.1 hypothetical protein -
  M2904_RS06395 (M2904_06395) - 1317534..1318460 (-) 927 WP_248848557.1 hypothetical protein -
  M2904_RS06400 (M2904_06400) - 1318477..1319064 (-) 588 WP_248852969.1 phage scaffolding protein -
  M2904_RS06405 (M2904_06405) - 1319176..1319379 (-) 204 WP_248852111.1 hypothetical protein -
  M2904_RS06410 (M2904_06410) - 1319389..1320186 (-) 798 WP_248852970.1 phage minor head protein -
  M2904_RS06415 (M2904_06415) - 1320254..1321774 (-) 1521 WP_248848553.1 phage portal protein -
  M2904_RS06420 (M2904_06420) - 1321789..1323042 (-) 1254 WP_248848552.1 hypothetical protein -
  M2904_RS06425 (M2904_06425) - 1323039..1323500 (-) 462 WP_248849494.1 helix-turn-helix domain-containing protein -
  M2904_RS06430 (M2904_06430) - 1323684..1323992 (-) 309 WP_248853463.1 helix-turn-helix transcriptional regulator -
  M2904_RS06435 (M2904_06435) - 1324003..1324314 (-) 312 WP_248852971.1 hypothetical protein -
  M2904_RS06440 (M2904_06440) - 1324517..1324735 (-) 219 WP_248848549.1 hypothetical protein -
  M2904_RS06445 (M2904_06445) ssb 1324747..1325265 (-) 519 WP_248852972.1 single-stranded DNA-binding protein Machinery gene
  M2904_RS06450 (M2904_06450) - 1325258..1325749 (-) 492 WP_248848547.1 hypothetical protein -
  M2904_RS06455 (M2904_06455) - 1325749..1326120 (-) 372 WP_248852107.1 hypothetical protein -
  M2904_RS06460 (M2904_06460) - 1326145..1326381 (-) 237 WP_248852106.1 hypothetical protein -
  M2904_RS06465 (M2904_06465) - 1326487..1326789 (-) 303 WP_248852105.1 MazG-like family protein -
  M2904_RS06470 (M2904_06470) - 1326782..1327009 (-) 228 WP_248852104.1 hypothetical protein -
  M2904_RS06475 (M2904_06475) - 1326987..1327217 (-) 231 WP_248852973.1 hypothetical protein -
  M2904_RS06480 (M2904_06480) - 1327207..1327410 (-) 204 WP_248852102.1 hypothetical protein -
  M2904_RS06485 (M2904_06485) - 1327426..1327704 (-) 279 WP_248852101.1 hypothetical protein -
  M2904_RS06490 (M2904_06490) - 1327705..1328127 (-) 423 WP_248852100.1 RusA family crossover junction endodeoxyribonuclease -
  M2904_RS06495 (M2904_06495) - 1328139..1328294 (-) 156 WP_248848544.1 hypothetical protein -
  M2904_RS06500 (M2904_06500) - 1328278..1328466 (-) 189 WP_248852099.1 hypothetical protein -
  M2904_RS06505 (M2904_06505) - 1328477..1329310 (-) 834 WP_248852098.1 ATP-binding protein -
  M2904_RS06510 (M2904_06510) - 1329279..1330061 (-) 783 WP_248852097.1 phage replisome organizer N-terminal domain-containing protein -
  M2904_RS06515 (M2904_06515) - 1330065..1330673 (-) 609 WP_248852974.1 putative HNHc nuclease -
  M2904_RS06520 (M2904_06520) - 1330739..1331692 (-) 954 WP_248852095.1 DUF1351 domain-containing protein -
  M2904_RS06525 (M2904_06525) - 1331689..1332432 (-) 744 WP_248852814.1 ERF family protein -
  M2904_RS06530 (M2904_06530) - 1332665..1332808 (-) 144 WP_248852094.1 hypothetical protein -
  M2904_RS06535 (M2904_06535) - 1332821..1333516 (-) 696 WP_248852093.1 Rha family transcriptional regulator -
  M2904_RS06540 (M2904_06540) - 1333683..1333889 (-) 207 WP_248852092.1 helix-turn-helix transcriptional regulator -
  M2904_RS06545 (M2904_06545) - 1334028..1334666 (+) 639 WP_248852091.1 XRE family transcriptional regulator -
  M2904_RS06550 (M2904_06550) - 1334753..1335259 (+) 507 WP_248852090.1 hypothetical protein -
  M2904_RS06555 (M2904_06555) - 1335289..1335489 (+) 201 WP_248852089.1 hypothetical protein -
  M2904_RS06560 (M2904_06560) - 1335593..1337023 (+) 1431 WP_248852088.1 recombinase family protein -

Sequence

Protein


Download         Length: 172 a.a.        Molecular weight: 19441.18 Da        Isoelectric Point: 5.2670

>NTDB_id=686718 M2904_RS06445 WP_248852972.1 1324747..1325265(-) (ssb) [Vagococcus lutrae strain AT15]
MINNTVLVGRLTRDPDLRYTSNGIAAASFTLAVNRNFTNASGEREADFINCVIWRKAAENLANYARKGTLIGITGRIQTR
NYENQQGQRVYVTEVVADNFQLLEKRQDNSGGGYQNNQQGNYNQNNFNNTQNQNQTFRQSSMPGLDERGFNTDSEPFGRS
SKIEINDDDLPF

Nucleotide


Download         Length: 519 bp        

>NTDB_id=686718 M2904_RS06445 WP_248852972.1 1324747..1325265(-) (ssb) [Vagococcus lutrae strain AT15]
ATGATTAATAATACGGTACTTGTTGGCCGTCTGACACGAGATCCGGATTTAAGATATACCAGTAACGGAATAGCGGCAGC
AAGTTTCACATTGGCAGTAAACAGAAACTTTACTAATGCAAGCGGAGAAAGAGAAGCAGACTTCATTAATTGTGTGATAT
GGAGAAAAGCAGCAGAGAATCTAGCAAACTACGCAAGAAAAGGAACACTTATTGGAATCACAGGTCGGATCCAGACAAGA
AATTATGAGAATCAGCAAGGCCAAAGAGTATACGTAACAGAAGTTGTTGCTGATAACTTTCAGTTGCTCGAAAAACGGCA
AGATAACAGCGGTGGTGGCTACCAAAATAACCAACAGGGGAATTATAACCAAAACAATTTTAACAACACACAGAACCAAA
ATCAGACGTTTAGACAAAGTAGTATGCCTGGACTGGATGAAAGAGGTTTTAATACAGATAGTGAACCATTTGGACGTAGT
AGCAAGATTGAAATTAATGATGATGACTTGCCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

57.386

100

0.587
  ssbA Bacillus subtilis subsp. subtilis str. 168

48.99

100

0.564
  ssbB Bacillus subtilis subsp. subtilis str. 168

62.264

61.628

0.384