Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M2908_RS07360 | Genome accession | NZ_CP097045 |
| Coordinates | 1521631..1522149 (+) | Length | 172 a.a. |
| NCBI ID | WP_248848548.1 | Uniprot ID | - |
| Organism | Vagococcus lutrae strain AT32 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1505250..1542837 | 1521631..1522149 | within | 0 |
Gene organization within MGE regions
Location: 1505250..1542837
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2908_RS07220 (M2908_07220) | - | 1505250..1505771 (+) | 522 | WP_126762370.1 | NYN domain-containing protein | - |
| M2908_RS07225 (M2908_07225) | - | 1505860..1506861 (+) | 1002 | WP_126762372.1 | putative sulfate exporter family transporter | - |
| M2908_RS07230 (M2908_07230) | - | 1506936..1507661 (+) | 726 | WP_126762373.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
| M2908_RS07235 (M2908_07235) | comGA | 1507774..1508793 (+) | 1020 | WP_248852086.1 | competence type IV pilus ATPase ComGA | - |
| M2908_RS07240 (M2908_07240) | comGB | 1508693..1509805 (+) | 1113 | WP_248852087.1 | competence type IV pilus assembly protein ComGB | - |
| M2908_RS07245 (M2908_07245) | - | 1509873..1511303 (-) | 1431 | WP_248852088.1 | recombinase family protein | - |
| M2908_RS07250 (M2908_07250) | - | 1511407..1511607 (-) | 201 | WP_248852089.1 | hypothetical protein | - |
| M2908_RS07255 (M2908_07255) | - | 1511637..1512143 (-) | 507 | WP_248852090.1 | hypothetical protein | - |
| M2908_RS07260 (M2908_07260) | - | 1512230..1512868 (-) | 639 | WP_248852091.1 | XRE family transcriptional regulator | - |
| M2908_RS07265 (M2908_07265) | - | 1513007..1513213 (+) | 207 | WP_248852092.1 | helix-turn-helix transcriptional regulator | - |
| M2908_RS07270 (M2908_07270) | - | 1513380..1514075 (+) | 696 | WP_248852093.1 | Rha family transcriptional regulator | - |
| M2908_RS07275 (M2908_07275) | - | 1514088..1514231 (+) | 144 | WP_248852094.1 | hypothetical protein | - |
| M2908_RS07280 (M2908_07280) | - | 1514464..1515207 (+) | 744 | WP_248852814.1 | ERF family protein | - |
| M2908_RS07285 (M2908_07285) | - | 1515204..1516157 (+) | 954 | WP_248852095.1 | DUF1351 domain-containing protein | - |
| M2908_RS07290 (M2908_07290) | - | 1516169..1516831 (+) | 663 | WP_248852096.1 | putative HNHc nuclease | - |
| M2908_RS07295 (M2908_07295) | - | 1516835..1517617 (+) | 783 | WP_248852097.1 | phage replisome organizer N-terminal domain-containing protein | - |
| M2908_RS07300 (M2908_07300) | - | 1517586..1518419 (+) | 834 | WP_248852098.1 | ATP-binding protein | - |
| M2908_RS07305 (M2908_07305) | - | 1518430..1518618 (+) | 189 | WP_248852099.1 | hypothetical protein | - |
| M2908_RS07310 (M2908_07310) | - | 1518602..1518757 (+) | 156 | WP_248848544.1 | hypothetical protein | - |
| M2908_RS07315 (M2908_07315) | - | 1518769..1519191 (+) | 423 | WP_248852100.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M2908_RS07320 (M2908_07320) | - | 1519192..1519470 (+) | 279 | WP_248852101.1 | hypothetical protein | - |
| M2908_RS07325 (M2908_07325) | - | 1519486..1519689 (+) | 204 | WP_248852102.1 | hypothetical protein | - |
| M2908_RS07330 (M2908_07330) | - | 1519679..1519909 (+) | 231 | WP_248852103.1 | hypothetical protein | - |
| M2908_RS07335 (M2908_07335) | - | 1519887..1520114 (+) | 228 | WP_248852104.1 | hypothetical protein | - |
| M2908_RS07340 (M2908_07340) | - | 1520107..1520409 (+) | 303 | WP_248852105.1 | MazG-like family protein | - |
| M2908_RS07345 (M2908_07345) | - | 1520515..1520751 (+) | 237 | WP_248852106.1 | hypothetical protein | - |
| M2908_RS07350 (M2908_07350) | - | 1520776..1521147 (+) | 372 | WP_248852107.1 | hypothetical protein | - |
| M2908_RS07355 (M2908_07355) | - | 1521147..1521638 (+) | 492 | WP_248848547.1 | hypothetical protein | - |
| M2908_RS07360 (M2908_07360) | ssb | 1521631..1522149 (+) | 519 | WP_248848548.1 | single-stranded DNA-binding protein | Machinery gene |
| M2908_RS07365 (M2908_07365) | - | 1522161..1522379 (+) | 219 | WP_248848549.1 | hypothetical protein | - |
| M2908_RS07370 (M2908_07370) | - | 1522582..1522893 (+) | 312 | WP_248848551.1 | hypothetical protein | - |
| M2908_RS07375 (M2908_07375) | - | 1523111..1523572 (+) | 462 | WP_248849494.1 | helix-turn-helix domain-containing protein | - |
| M2908_RS07380 (M2908_07380) | - | 1523569..1524822 (+) | 1254 | WP_248852108.1 | hypothetical protein | - |
| M2908_RS07385 (M2908_07385) | - | 1524837..1526357 (+) | 1521 | WP_248852109.1 | phage portal protein | - |
| M2908_RS07390 (M2908_07390) | - | 1526425..1527222 (+) | 798 | WP_248852110.1 | phage minor head protein | - |
| M2908_RS07395 (M2908_07395) | - | 1527232..1527435 (+) | 204 | WP_248852111.1 | hypothetical protein | - |
| M2908_RS07400 (M2908_07400) | - | 1527547..1528134 (+) | 588 | WP_248848556.1 | phage scaffolding protein | - |
| M2908_RS07405 (M2908_07405) | - | 1528151..1529077 (+) | 927 | WP_248852112.1 | hypothetical protein | - |
| M2908_RS07410 (M2908_07410) | - | 1529082..1529354 (+) | 273 | WP_248852113.1 | hypothetical protein | - |
| M2908_RS07415 (M2908_07415) | - | 1529381..1529914 (+) | 534 | WP_248852114.1 | hypothetical protein | - |
| M2908_RS07420 (M2908_07420) | - | 1529914..1530243 (+) | 330 | WP_248852115.1 | head-tail adaptor protein | - |
| M2908_RS07425 (M2908_07425) | - | 1530236..1530670 (+) | 435 | WP_248848561.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| M2908_RS07430 (M2908_07430) | - | 1530676..1531044 (+) | 369 | WP_248848562.1 | hypothetical protein | - |
| M2908_RS07435 (M2908_07435) | - | 1531044..1531646 (+) | 603 | WP_248848563.1 | hypothetical protein | - |
| M2908_RS07440 (M2908_07440) | - | 1531649..1532089 (+) | 441 | WP_248852116.1 | hypothetical protein | - |
| M2908_RS07445 (M2908_07445) | - | 1532430..1535180 (+) | 2751 | WP_248852117.1 | hypothetical protein | - |
| M2908_RS07450 (M2908_07450) | - | 1535184..1535840 (+) | 657 | WP_248852118.1 | hypothetical protein | - |
| M2908_RS07455 (M2908_07455) | - | 1535840..1538746 (+) | 2907 | WP_248852119.1 | phage tail spike protein | - |
| M2908_RS07460 (M2908_07460) | - | 1538747..1540717 (+) | 1971 | WP_248852120.1 | DUF859 family phage minor structural protein | - |
| M2908_RS07465 (M2908_07465) | - | 1540711..1541031 (+) | 321 | WP_248852121.1 | hypothetical protein | - |
| M2908_RS07470 (M2908_07470) | - | 1541194..1541535 (+) | 342 | WP_248848570.1 | hypothetical protein | - |
| M2908_RS07475 (M2908_07475) | - | 1541541..1541807 (+) | 267 | WP_248848571.1 | phage holin family protein | - |
| M2908_RS07480 (M2908_07480) | - | 1541812..1542837 (+) | 1026 | WP_248852122.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 172 a.a. Molecular weight: 19468.21 Da Isoelectric Point: 5.2670
>NTDB_id=686590 M2908_RS07360 WP_248848548.1 1521631..1522149(+) (ssb) [Vagococcus lutrae strain AT32]
MINNTVLVGRLTRDPDLRYTSNGIAAASFTLAVNRNFTNASGEREADFINCVIWRKAAENLANYARKGTLIGITGRIQTR
NYENQQGQRVYVTEVVADNFQLLEKRQDNSGGGYQNNQQGNYNQNNFNNTQNQNQTFRQSSMPGLDERGFNTDSEPFGRS
NKIEINDDDLPF
MINNTVLVGRLTRDPDLRYTSNGIAAASFTLAVNRNFTNASGEREADFINCVIWRKAAENLANYARKGTLIGITGRIQTR
NYENQQGQRVYVTEVVADNFQLLEKRQDNSGGGYQNNQQGNYNQNNFNNTQNQNQTFRQSSMPGLDERGFNTDSEPFGRS
NKIEINDDDLPF
Nucleotide
Download Length: 519 bp
>NTDB_id=686590 M2908_RS07360 WP_248848548.1 1521631..1522149(+) (ssb) [Vagococcus lutrae strain AT32]
ATGATTAATAATACGGTACTTGTTGGCCGTCTGACACGAGATCCGGATTTAAGATATACCAGTAACGGAATAGCGGCAGC
AAGTTTCACATTGGCAGTAAACAGAAACTTTACTAATGCAAGCGGAGAAAGAGAAGCAGACTTCATTAATTGTGTGATAT
GGAGAAAAGCAGCAGAGAATCTAGCAAACTACGCAAGAAAAGGAACACTTATTGGAATCACAGGTCGGATCCAGACAAGA
AATTATGAGAATCAGCAAGGCCAAAGAGTATACGTAACAGAAGTTGTTGCTGATAACTTTCAGTTGCTCGAAAAACGGCA
AGATAACAGCGGTGGTGGCTACCAAAATAACCAACAGGGGAATTATAACCAAAACAATTTTAACAACACACAGAACCAAA
ATCAGACGTTTAGACAAAGTAGTATGCCTGGACTGGATGAAAGAGGTTTTAATACAGATAGTGAACCATTTGGACGTAGT
AACAAGATTGAAATTAATGATGATGACTTGCCATTTTAA
ATGATTAATAATACGGTACTTGTTGGCCGTCTGACACGAGATCCGGATTTAAGATATACCAGTAACGGAATAGCGGCAGC
AAGTTTCACATTGGCAGTAAACAGAAACTTTACTAATGCAAGCGGAGAAAGAGAAGCAGACTTCATTAATTGTGTGATAT
GGAGAAAAGCAGCAGAGAATCTAGCAAACTACGCAAGAAAAGGAACACTTATTGGAATCACAGGTCGGATCCAGACAAGA
AATTATGAGAATCAGCAAGGCCAAAGAGTATACGTAACAGAAGTTGTTGCTGATAACTTTCAGTTGCTCGAAAAACGGCA
AGATAACAGCGGTGGTGGCTACCAAAATAACCAACAGGGGAATTATAACCAAAACAATTTTAACAACACACAGAACCAAA
ATCAGACGTTTAGACAAAGTAGTATGCCTGGACTGGATGAAAGAGGTTTTAATACAGATAGTGAACCATTTGGACGTAGT
AACAAGATTGAAATTAATGATGATGACTTGCCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.386 |
100 |
0.587 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
48.99 |
100 |
0.564 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
62.264 |
61.628 |
0.384 |