Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   M2909_RS04355 Genome accession   NZ_CP097044
Coordinates   884836..885354 (-) Length   172 a.a.
NCBI ID   WP_248848548.1    Uniprot ID   -
Organism   Vagococcus lutrae strain AT33     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 864148..898151 884836..885354 within 0


Gene organization within MGE regions


Location: 864148..898151
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M2909_RS04230 (M2909_04230) - 864148..865173 (-) 1026 WP_248852122.1 N-acetylmuramoyl-L-alanine amidase -
  M2909_RS04235 (M2909_04235) - 865178..865444 (-) 267 WP_248848571.1 phage holin family protein -
  M2909_RS04240 (M2909_04240) - 865450..865791 (-) 342 WP_248848570.1 hypothetical protein -
  M2909_RS04245 (M2909_04245) - 865954..866274 (-) 321 WP_248852121.1 hypothetical protein -
  M2909_RS04250 (M2909_04250) - 866268..868238 (-) 1971 WP_248852120.1 DUF859 family phage minor structural protein -
  M2909_RS04255 (M2909_04255) - 868239..871145 (-) 2907 WP_248852119.1 phage tail spike protein -
  M2909_RS04260 (M2909_04260) - 871145..871801 (-) 657 WP_248852118.1 hypothetical protein -
  M2909_RS04265 (M2909_04265) - 871805..874555 (-) 2751 WP_248852117.1 hypothetical protein -
  M2909_RS04270 (M2909_04270) - 874585..874785 (-) 201 WP_248857225.1 peptide methionine sulfoxide reductase -
  M2909_RS04275 (M2909_04275) - 874896..875336 (-) 441 WP_248852116.1 hypothetical protein -
  M2909_RS04280 (M2909_04280) - 875339..875941 (-) 603 WP_248848563.1 hypothetical protein -
  M2909_RS04285 (M2909_04285) - 875941..876309 (-) 369 WP_248848562.1 hypothetical protein -
  M2909_RS04290 (M2909_04290) - 876315..876749 (-) 435 WP_248848561.1 HK97-gp10 family putative phage morphogenesis protein -
  M2909_RS04295 (M2909_04295) - 876742..877071 (-) 330 WP_248852115.1 head-tail adaptor protein -
  M2909_RS04300 (M2909_04300) - 877071..877604 (-) 534 WP_248852114.1 hypothetical protein -
  M2909_RS04305 (M2909_04305) - 877631..877903 (-) 273 WP_248852113.1 hypothetical protein -
  M2909_RS04310 (M2909_04310) - 877908..878834 (-) 927 WP_248852112.1 hypothetical protein -
  M2909_RS04315 (M2909_04315) - 878851..879438 (-) 588 WP_248848556.1 phage scaffolding protein -
  M2909_RS04320 (M2909_04320) - 879550..879753 (-) 204 WP_248852111.1 hypothetical protein -
  M2909_RS04325 (M2909_04325) - 879763..880560 (-) 798 WP_248852110.1 phage minor head protein -
  M2909_RS04330 (M2909_04330) - 880628..882148 (-) 1521 WP_248852109.1 phage portal protein -
  M2909_RS04335 (M2909_04335) - 882163..883416 (-) 1254 WP_248852108.1 hypothetical protein -
  M2909_RS04340 (M2909_04340) - 883413..883874 (-) 462 WP_248849494.1 helix-turn-helix domain-containing protein -
  M2909_RS04345 (M2909_04345) - 884092..884403 (-) 312 WP_248848551.1 hypothetical protein -
  M2909_RS04350 (M2909_04350) - 884606..884824 (-) 219 WP_248848549.1 hypothetical protein -
  M2909_RS04355 (M2909_04355) ssb 884836..885354 (-) 519 WP_248848548.1 single-stranded DNA-binding protein Machinery gene
  M2909_RS04360 (M2909_04360) - 885347..885838 (-) 492 WP_248848547.1 hypothetical protein -
  M2909_RS04365 (M2909_04365) - 885838..886209 (-) 372 WP_248852107.1 hypothetical protein -
  M2909_RS04370 (M2909_04370) - 886234..886470 (-) 237 WP_248852106.1 hypothetical protein -
  M2909_RS04375 (M2909_04375) - 886576..886878 (-) 303 WP_248852105.1 MazG-like family protein -
  M2909_RS04380 (M2909_04380) - 886871..887098 (-) 228 WP_248852104.1 hypothetical protein -
  M2909_RS04385 (M2909_04385) - 887076..887306 (-) 231 WP_248852103.1 hypothetical protein -
  M2909_RS04390 (M2909_04390) - 887296..887499 (-) 204 WP_248852102.1 hypothetical protein -
  M2909_RS04395 (M2909_04395) - 887515..887784 (-) 270 WP_248857226.1 hypothetical protein -
  M2909_RS04400 (M2909_04400) - 887794..888216 (-) 423 WP_248852100.1 RusA family crossover junction endodeoxyribonuclease -
  M2909_RS04405 (M2909_04405) - 888228..888383 (-) 156 WP_248848544.1 hypothetical protein -
  M2909_RS04410 (M2909_04410) - 888367..888555 (-) 189 WP_248852099.1 hypothetical protein -
  M2909_RS04415 (M2909_04415) - 888566..889399 (-) 834 WP_248852098.1 ATP-binding protein -
  M2909_RS04420 (M2909_04420) - 889368..890150 (-) 783 WP_248852097.1 phage replisome organizer N-terminal domain-containing protein -
  M2909_RS04425 (M2909_04425) - 890154..890816 (-) 663 WP_248852096.1 putative HNHc nuclease -
  M2909_RS04430 (M2909_04430) - 890828..891781 (-) 954 WP_248852095.1 DUF1351 domain-containing protein -
  M2909_RS04435 (M2909_04435) - 891778..892521 (-) 744 WP_248852814.1 ERF family protein -
  M2909_RS04440 (M2909_04440) - 892754..892897 (-) 144 WP_248852094.1 hypothetical protein -
  M2909_RS04445 (M2909_04445) - 892910..893605 (-) 696 WP_248852093.1 Rha family transcriptional regulator -
  M2909_RS04450 (M2909_04450) - 893772..893978 (-) 207 WP_248852092.1 helix-turn-helix transcriptional regulator -
  M2909_RS04455 (M2909_04455) - 894117..894755 (+) 639 WP_248852091.1 XRE family transcriptional regulator -
  M2909_RS04460 (M2909_04460) - 894842..895348 (+) 507 WP_248852090.1 hypothetical protein -
  M2909_RS04465 (M2909_04465) - 895378..895578 (+) 201 WP_248852089.1 hypothetical protein -
  M2909_RS04470 (M2909_04470) - 895682..897112 (+) 1431 WP_248852088.1 recombinase family protein -

Sequence


Protein


Download         Length: 172 a.a.        Molecular weight: 19468.21 Da        Isoelectric Point: 5.2670

>NTDB_id=686544 M2909_RS04355 WP_248848548.1 884836..885354(-) (ssb) [Vagococcus lutrae strain AT33]
MINNTVLVGRLTRDPDLRYTSNGIAAASFTLAVNRNFTNASGEREADFINCVIWRKAAENLANYARKGTLIGITGRIQTR
NYENQQGQRVYVTEVVADNFQLLEKRQDNSGGGYQNNQQGNYNQNNFNNTQNQNQTFRQSSMPGLDERGFNTDSEPFGRS
NKIEINDDDLPF

Nucleotide


Download         Length: 519 bp        

>NTDB_id=686544 M2909_RS04355 WP_248848548.1 884836..885354(-) (ssb) [Vagococcus lutrae strain AT33]
ATGATTAATAATACGGTACTTGTTGGCCGTCTGACACGAGATCCGGATTTAAGATATACCAGTAACGGAATAGCGGCAGC
AAGTTTCACATTGGCAGTAAACAGAAACTTTACTAATGCAAGCGGAGAAAGAGAAGCAGACTTCATTAATTGTGTGATAT
GGAGAAAAGCAGCAGAGAATCTAGCAAACTACGCAAGAAAAGGAACACTTATTGGAATCACAGGTCGGATCCAGACAAGA
AATTATGAGAATCAGCAAGGCCAAAGAGTATACGTAACAGAAGTTGTTGCTGATAACTTTCAGTTGCTCGAAAAACGGCA
AGATAACAGCGGTGGTGGCTACCAAAATAACCAACAGGGGAATTATAACCAAAACAATTTTAACAACACACAGAACCAAA
ATCAGACGTTTAGACAAAGTAGTATGCCTGGACTGGATGAAAGAGGTTTTAATACAGATAGTGAACCATTTGGACGTAGT
AACAAGATTGAAATTAATGATGATGACTTGCCATTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

57.386

100

0.587

  ssbA Bacillus subtilis subsp. subtilis str. 168

48.99

100

0.564

  ssbB Bacillus subtilis subsp. subtilis str. 168

62.264

61.628

0.384