Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   CCX78_RS03250 Genome accession   NZ_AP017931
Coordinates   619806..620111 (+) Length   101 a.a.
NCBI ID   WP_011374997.1    Uniprot ID   Q38W27
Organism   Latilactobacillus sakei strain LK-145     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 614806..625111
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CCX78_RS03215 (LASAK_00635) - 615300..615692 (-) 393 WP_231952369.1 hypothetical protein -
  CCX78_RS03220 (LASAK_00636) - 615771..616271 (+) 501 WP_011375003.1 VanZ family protein -
  CCX78_RS03225 (LASAK_00637) - 616362..617093 (+) 732 WP_011375002.1 YebC/PmpR family DNA-binding transcriptional regulator -
  CCX78_RS03230 (LASAK_00638) comGA 617209..618099 (+) 891 WP_016265378.1 competence type IV pilus ATPase ComGA Machinery gene
  CCX78_RS03235 (LASAK_00639) comGB 618092..619099 (+) 1008 WP_011375000.1 type II secretion system F family protein Machinery gene
  CCX78_RS03240 (LASAK_00640) comGC 619096..619395 (+) 300 WP_011374999.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  CCX78_RS03245 (LASAK_00641) comGD 619367..619819 (+) 453 WP_035145016.1 competence type IV pilus minor pilin ComGD Machinery gene
  CCX78_RS03250 (LASAK_00642) comGE 619806..620111 (+) 306 WP_011374997.1 hypothetical protein Machinery gene
  CCX78_RS03255 (LASAK_00643) comGF 620077..620598 (+) 522 WP_112234088.1 competence type IV pilus minor pilin ComGF Machinery gene
  CCX78_RS03260 (LASAK_00644) - 620633..620899 (+) 267 WP_172425585.1 hypothetical protein -
  CCX78_RS03265 (LASAK_00645) - 621014..622033 (+) 1020 WP_231952370.1 class I SAM-dependent methyltransferase -
  CCX78_RS03270 (LASAK_00646) - 622055..623251 (+) 1197 WP_096584647.1 acetate/propionate family kinase -
  CCX78_RS03275 (LASAK_00647) - 623306..623764 (+) 459 WP_096584650.1 laaL -
  CCX78_RS03285 (LASAK_00648) - 624307..624672 (-) 366 WP_011374991.1 DUF805 domain-containing protein -
  CCX78_RS10425 - 624798..624929 (-) 132 WP_231952371.1 TraX family protein -

Sequence


Protein


Download         Length: 101 a.a.        Molecular weight: 11425.39 Da        Isoelectric Point: 11.1577

>NTDB_id=68587 CCX78_RS03250 WP_011374997.1 619806..620111(+) (comGE) [Latilactobacillus sakei strain LK-145]
MFRSRPAFSLVENIIALTLVLGACWLLTVSLLHFKQQQTLKQQQVAQQAVLAMAAEQLRAHQTVKKRWQMGRTIYTVTAN
QQKLKVTTKAGESVAINWTTD

Nucleotide


Download         Length: 306 bp        

>NTDB_id=68587 CCX78_RS03250 WP_011374997.1 619806..620111(+) (comGE) [Latilactobacillus sakei strain LK-145]
ATGTTCAGAAGTAGGCCGGCTTTTTCACTCGTTGAAAATATCATCGCCTTAACCTTAGTATTAGGGGCTTGCTGGCTATT
AACGGTAAGTCTACTACACTTTAAGCAACAACAAACGCTTAAACAACAGCAAGTTGCACAACAGGCGGTTCTAGCAATGG
CCGCTGAGCAGTTGAGAGCGCATCAGACAGTGAAAAAACGCTGGCAAATGGGGCGAACAATCTATACGGTGACGGCTAAT
CAGCAGAAATTAAAGGTAACCACAAAGGCAGGTGAGTCGGTTGCGATTAATTGGACGACCGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q38W27

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Latilactobacillus sakei subsp. sakei 23K

100

100

1


Multiple sequence alignment