Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   LFL98_RS16510 Genome accession   NZ_CP110365
Coordinates   3134097..3134237 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain HY2-62     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3129097..3139237
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LFL98_RS16485 (LFL98_16490) yuxO 3129373..3129753 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  LFL98_RS16490 (LFL98_16495) comA 3129772..3130416 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  LFL98_RS16495 (LFL98_16500) comP 3130497..3132809 (-) 2313 WP_047183111.1 histidine kinase Regulator
  LFL98_RS16500 (LFL98_16505) comX 3132825..3133046 (-) 222 WP_014114983.1 competence pheromone ComX -
  LFL98_RS16505 (LFL98_16510) comQ 3133043..3133912 (-) 870 WP_277736668.1 polyprenyl synthetase family protein Regulator
  LFL98_RS16510 (LFL98_16515) degQ 3134097..3134237 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  LFL98_RS16515 (LFL98_16520) - 3134460..3134522 (+) 63 Protein_3187 hypothetical protein -
  LFL98_RS16520 (LFL98_16525) - 3134699..3135067 (+) 369 WP_116315920.1 hypothetical protein -
  LFL98_RS16525 (LFL98_16530) pdeH 3135043..3136272 (-) 1230 WP_277736669.1 cyclic di-GMP phosphodiesterase -
  LFL98_RS16530 (LFL98_16535) pncB 3136409..3137881 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  LFL98_RS16535 (LFL98_16540) pncA 3137897..3138448 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  LFL98_RS16540 (LFL98_16545) yueI 3138545..3138943 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=684758 LFL98_RS16510 WP_003220708.1 3134097..3134237(-) (degQ) [Bacillus subtilis strain HY2-62]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=684758 LFL98_RS16510 WP_003220708.1 3134097..3134237(-) (degQ) [Bacillus subtilis strain HY2-62]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1