Detailed information    

insolico Bioinformatically predicted

Overview

Name   crp   Type   Regulator
Locus tag   M1S33_RS12525 Genome accession   NZ_CP096692
Coordinates   2623735..2624400 (+) Length   221 a.a.
NCBI ID   WP_000203219.1    Uniprot ID   A0A219CAS9
Organism   Acinetobacter baumannii strain 5779     
Function   regulate competence development (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2621554..2696596 2623735..2624400 within 0
IScluster/Tn 2624457..2625547 2623735..2624400 flank 57


Gene organization within MGE regions


Location: 2621554..2696596
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M1S33_RS12505 (M1S33_12505) - 2621554..2622360 (+) 807 WP_001237344.1 peptidoglycan DD-metalloendopeptidase family protein -
  M1S33_RS12510 (M1S33_12510) - 2622357..2622782 (-) 426 WP_001026230.1 GNAT family N-acetyltransferase -
  M1S33_RS12515 (M1S33_12515) - 2622874..2623296 (-) 423 WP_001195082.1 OsmC family protein -
  M1S33_RS12520 (M1S33_12520) - 2623375..2623494 (-) 120 Protein_2443 hypothetical protein -
  M1S33_RS12525 (M1S33_12525) crp 2623735..2624400 (+) 666 WP_000203219.1 cAMP-activated global transcriptional regulator CRP Regulator
  M1S33_RS12530 (M1S33_12530) - 2624457..2625547 (+) 1091 WP_085940413.1 IS4-like element ISAba1 family transposase -
  M1S33_RS12535 (M1S33_12535) - 2625792..2626841 (+) 1050 WP_001159802.1 NADP(H)-dependent aldo-keto reductase -
  M1S33_RS12540 (M1S33_12540) - 2626901..2627680 (-) 780 WP_001034598.1 M48 family metallopeptidase -
  M1S33_RS12545 (M1S33_12545) - 2627797..2628114 (-) 318 WP_000776215.1 hypothetical protein -
  M1S33_RS12550 (M1S33_12550) - 2628237..2629556 (-) 1320 WP_000517792.1 adenylosuccinate synthase -
  M1S33_RS12555 (M1S33_12555) - 2629621..2630787 (-) 1167 WP_000155680.1 ATP phosphoribosyltransferase regulatory subunit -
  M1S33_RS12560 (M1S33_12560) gap 2631063..2632088 (-) 1026 WP_001188823.1 type I glyceraldehyde-3-phosphate dehydrogenase -
  M1S33_RS12565 (M1S33_12565) alaS 2632358..2634994 (+) 2637 WP_000199457.1 alanine--tRNA ligase -
  M1S33_RS12570 (M1S33_12570) - 2635060..2636340 (+) 1281 WP_001185176.1 aspartate kinase -
  M1S33_RS12575 (M1S33_12575) csrA 2636587..2636841 (+) 255 WP_000906487.1 carbon storage regulator CsrA -
  M1S33_RS12580 (M1S33_12580) rnhB 2636911..2637477 (-) 567 WP_000495836.1 ribonuclease HII -
  M1S33_RS12585 (M1S33_12585) - 2637543..2637932 (-) 390 WP_000735756.1 hypothetical protein -
  M1S33_RS12590 (M1S33_12590) - 2638171..2638728 (+) 558 WP_001111760.1 cytochrome b -
  M1S33_RS12595 (M1S33_12595) - 2638772..2639770 (-) 999 WP_001077405.1 adenosine deaminase -
  M1S33_RS12600 (M1S33_12600) - 2639882..2641201 (-) 1320 WP_000729980.1 NCS2 family permease -
  M1S33_RS12605 (M1S33_12605) - 2641524..2641751 (-) 228 WP_000608973.1 hypothetical protein -
  M1S33_RS12610 (M1S33_12610) - 2642120..2643670 (-) 1551 WP_000256760.1 NAD(P)/FAD-dependent oxidoreductase -
  M1S33_RS12615 (M1S33_12615) - 2643694..2644524 (-) 831 WP_000599996.1 SDR family NAD(P)-dependent oxidoreductase -
  M1S33_RS12620 (M1S33_12620) - 2644590..2645552 (-) 963 WP_000226456.1 metal-dependent hydrolase -
  M1S33_RS12625 (M1S33_12625) - 2646063..2646785 (+) 723 WP_000459997.1 pirin family protein -
  M1S33_RS12630 (M1S33_12630) - 2646850..2647473 (-) 624 WP_000107496.1 TetR/AcrR family transcriptional regulator -
  M1S33_RS12635 (M1S33_12635) - 2647533..2648237 (-) 705 WP_001067855.1 IS6-like element IS26 family transposase -
  M1S33_RS12640 (M1S33_12640) - 2648367..2649182 (+) 816 WP_000018326.1 aminoglycoside O-phosphotransferase APH(3')-Ia -
  M1S33_RS12645 (M1S33_12645) - 2649336..2649515 (-) 180 WP_000902128.1 hypothetical protein -
  M1S33_RS12650 (M1S33_12650) - 2649607..2650311 (-) 705 WP_001067858.1 IS6-like element IS26 family transposase -
  M1S33_RS12655 (M1S33_12655) - 2650323..2650982 (-) 660 WP_000904905.1 recombinase family protein -
  M1S33_RS12660 (M1S33_12660) - 2651093..2653946 (-) 2854 Protein_2471 Tn3 family transposase -
  M1S33_RS12665 (M1S33_12665) - 2654007..2654711 (+) 705 WP_001067855.1 IS6-like element IS26 family transposase -
  M1S33_RS12670 (M1S33_12670) - 2654782..2655642 (-) 861 WP_000027057.1 broad-spectrum class A beta-lactamase TEM-1 -
  M1S33_RS12675 (M1S33_12675) - 2655825..2656364 (-) 540 WP_029642339.1 recombinase family protein -
  M1S33_RS12680 (M1S33_12680) - 2656394..2657098 (-) 705 WP_001067855.1 IS6-like element IS26 family transposase -
  M1S33_RS12685 (M1S33_12685) - 2657228..2658043 (+) 816 WP_000018326.1 aminoglycoside O-phosphotransferase APH(3')-Ia -
  M1S33_RS12690 (M1S33_12690) - 2658197..2658376 (-) 180 WP_000902128.1 hypothetical protein -
  M1S33_RS12695 (M1S33_12695) - 2658468..2659172 (-) 705 WP_001067858.1 IS6-like element IS26 family transposase -
  M1S33_RS12700 (M1S33_12700) - 2659184..2659843 (-) 660 WP_000904905.1 recombinase family protein -
  M1S33_RS12705 (M1S33_12705) - 2659954..2662806 (-) 2853 Protein_2480 Tn3 family transposase -
  M1S33_RS12710 (M1S33_12710) - 2662867..2663571 (+) 705 WP_001067855.1 IS6-like element IS26 family transposase -
  M1S33_RS12715 (M1S33_12715) - 2663642..2664502 (-) 861 WP_000027057.1 broad-spectrum class A beta-lactamase TEM-1 -
  M1S33_RS12720 (M1S33_12720) - 2664685..2665223 (-) 539 Protein_2483 recombinase family protein -
  M1S33_RS12725 (M1S33_12725) - 2665253..2665957 (-) 705 WP_001067855.1 IS6-like element IS26 family transposase -
  M1S33_RS12730 (M1S33_12730) - 2666087..2666894 (+) 808 Protein_2485 APH(3')-I family aminoglycoside O-phosphotransferase -
  M1S33_RS12735 (M1S33_12735) - 2667022..2667222 (-) 201 WP_249375056.1 hypothetical protein -
  M1S33_RS12740 (M1S33_12740) - 2667312..2668012 (-) 701 Protein_2487 IS6 family transposase -
  M1S33_RS12745 (M1S33_12745) - 2668024..2668683 (-) 660 WP_000904905.1 recombinase family protein -
  M1S33_RS12750 (M1S33_12750) - 2668794..2671644 (-) 2851 Protein_2489 Tn3 family transposase -
  M1S33_RS12755 (M1S33_12755) - 2671705..2672409 (+) 705 WP_001067855.1 IS6-like element IS26 family transposase -
  M1S33_RS12760 (M1S33_12760) - 2672480..2673340 (-) 861 WP_000027057.1 broad-spectrum class A beta-lactamase TEM-1 -
  M1S33_RS12765 (M1S33_12765) - 2673523..2674062 (-) 540 WP_029642339.1 recombinase family protein -
  M1S33_RS12770 (M1S33_12770) - 2674092..2674796 (-) 705 WP_001067855.1 IS6-like element IS26 family transposase -
  M1S33_RS12775 (M1S33_12775) - 2674861..2675232 (+) 372 Protein_2494 M48 family metalloprotease -
  M1S33_RS12785 (M1S33_12785) - 2675572..2677602 (-) 2031 WP_000205077.1 NADPH-dependent 2,4-dienoyl-CoA reductase -
  M1S33_RS12790 (M1S33_12790) argG 2677868..2679226 (+) 1359 WP_001986427.1 argininosuccinate synthase -
  M1S33_RS12795 (M1S33_12795) - 2679285..2680547 (-) 1263 WP_000013374.1 diguanylate cyclase -
  M1S33_RS12800 (M1S33_12800) pyrC 2680697..2681731 (+) 1035 WP_001084867.1 dihydroorotase -
  M1S33_RS12805 (M1S33_12805) rnt 2681716..2682378 (+) 663 WP_001982681.1 ribonuclease T -
  M1S33_RS12815 (M1S33_12815) - 2682656..2684770 (+) 2115 WP_000364465.1 TonB-dependent receptor -
  M1S33_RS12820 (M1S33_12820) - 2684829..2686073 (-) 1245 WP_000077974.1 NADH:flavin oxidoreductase/NADH oxidase family protein -
  M1S33_RS12825 (M1S33_12825) - 2686259..2687848 (-) 1590 WP_000550783.1 dipeptide ABC transporter ATP-binding protein -
  M1S33_RS12830 (M1S33_12830) - 2687826..2688836 (-) 1011 WP_000008530.1 ABC transporter permease -
  M1S33_RS12835 (M1S33_12835) yejB 2688836..2689888 (-) 1053 WP_000536107.1 microcin C ABC transporter permease YejB -
  M1S33_RS12840 (M1S33_12840) - 2689918..2691753 (-) 1836 WP_001171034.1 extracellular solute-binding protein -
  M1S33_RS12845 (M1S33_12845) - 2691769..2694984 (-) 3216 WP_000277826.1 LysM peptidoglycan-binding domain-containing protein -
  M1S33_RS12850 (M1S33_12850) dnaQ 2695217..2696596 (+) 1380 WP_000084042.1 DNA polymerase III subunit epsilon -

Sequence

Protein


Download         Length: 221 a.a.        Molecular weight: 24956.78 Da        Isoelectric Point: 8.1128

>NTDB_id=682551 M1S33_RS12525 WP_000203219.1 2623735..2624400(+) (crp) [Acinetobacter baumannii strain 5779]
MTSNFSQLSTDALSPGQLPESVKALLKRAHINRYPKRTTIVDAGTESKSLYLILKGSVSIILREDDEREIVVAYLNPGDF
FGEMGLFEPNPQRTAEVRTRDVCEIAEISYDNFHELSKQYPDLSYAVFAQLVRRLKNTTRKMTDLAFIDVSGRIARCLID
LSSQPEAMILPNGRQIRITRQEIGRIVGCSREMVGRVLKTLEDQGMIQTDGKAILIFLCTR

Nucleotide


Download         Length: 666 bp        

>NTDB_id=682551 M1S33_RS12525 WP_000203219.1 2623735..2624400(+) (crp) [Acinetobacter baumannii strain 5779]
ATGACTTCAAATTTTTCACAACTCAGCACAGATGCTTTATCTCCGGGGCAACTACCTGAATCCGTTAAAGCATTGTTAAA
ACGTGCTCACATCAACAGATATCCAAAACGAACCACAATTGTTGATGCCGGAACAGAGTCAAAATCTTTATATTTAATTT
TAAAAGGCTCAGTTTCAATTATTTTACGTGAAGACGATGAACGTGAAATTGTTGTGGCATATTTGAATCCTGGTGACTTC
TTTGGGGAAATGGGGCTTTTCGAACCGAACCCTCAACGTACAGCTGAAGTTCGTACCCGTGATGTCTGTGAAATTGCGGA
AATTTCATATGACAACTTCCACGAACTGAGCAAACAGTATCCAGATCTCAGCTATGCCGTTTTCGCGCAACTCGTTCGTC
GTTTAAAAAATACAACTCGTAAAATGACCGATCTTGCATTTATTGATGTGTCAGGCCGTATTGCGCGTTGCTTAATCGAC
CTATCTTCACAACCAGAAGCAATGATCTTGCCGAATGGCCGTCAAATTCGTATTACTCGACAAGAGATTGGACGCATTGT
CGGGTGTTCACGAGAAATGGTTGGCCGTGTATTAAAGACCTTAGAAGATCAAGGTATGATTCAAACTGACGGTAAAGCTA
TTCTAATTTTTCTCTGTACACGATAA

Domains

Predicted by InterproScan.

Bacterial regulatory proteins, crp family (Crp)

(176-207)

Cyclic nucleotide-binding domain (cNMP_binding)

(33-120)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A219CAS9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  crp Acinetobacter baumannii D1279779

100

98.19

0.982
  crp Vibrio cholerae strain A1552

47.317

92.76

0.439
  crp Haemophilus influenzae Rd KW20

48.705

87.33

0.425