Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   MYE78_RS11695 Genome accession   NZ_CP095842
Coordinates   2439243..2439620 (-) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain EM-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2434243..2444620
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MYE78_RS11655 - 2434740..2435534 (+) 795 WP_007612541.1 YqhG family protein -
  MYE78_RS11660 sinI 2435711..2435884 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  MYE78_RS11665 sinR 2435918..2436253 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MYE78_RS11670 tasA 2436301..2437086 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  MYE78_RS11675 sipW 2437151..2437735 (-) 585 WP_032874025.1 signal peptidase I SipW -
  MYE78_RS11680 tapA 2437707..2438378 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  MYE78_RS11685 - 2438637..2438966 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  MYE78_RS11690 - 2439007..2439186 (-) 180 WP_022552966.1 YqzE family protein -
  MYE78_RS11695 comGG 2439243..2439620 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  MYE78_RS11700 comGF 2439621..2440121 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  MYE78_RS11705 comGE 2440030..2440344 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  MYE78_RS11710 comGD 2440328..2440765 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  MYE78_RS11715 comGC 2440755..2441063 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  MYE78_RS11720 comGB 2441068..2442105 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  MYE78_RS11725 comGA 2442092..2443162 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  MYE78_RS11730 - 2443359..2444309 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=678750 MYE78_RS11695 WP_032874019.1 2439243..2439620(-) (comGG) [Bacillus velezensis strain EM-1]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=678750 MYE78_RS11695 WP_032874019.1 2439243..2439620(-) (comGG) [Bacillus velezensis strain EM-1]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488