Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MYE78_RS11660 Genome accession   NZ_CP095842
Coordinates   2435711..2435884 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain EM-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2430711..2440884
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MYE78_RS11645 gcvT 2431525..2432625 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  MYE78_RS11650 - 2433048..2434718 (+) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  MYE78_RS11655 - 2434740..2435534 (+) 795 WP_007612541.1 YqhG family protein -
  MYE78_RS11660 sinI 2435711..2435884 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  MYE78_RS11665 sinR 2435918..2436253 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MYE78_RS11670 tasA 2436301..2437086 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  MYE78_RS11675 sipW 2437151..2437735 (-) 585 WP_032874025.1 signal peptidase I SipW -
  MYE78_RS11680 tapA 2437707..2438378 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  MYE78_RS11685 - 2438637..2438966 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  MYE78_RS11690 - 2439007..2439186 (-) 180 WP_022552966.1 YqzE family protein -
  MYE78_RS11695 comGG 2439243..2439620 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  MYE78_RS11700 comGF 2439621..2440121 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  MYE78_RS11705 comGE 2440030..2440344 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  MYE78_RS11710 comGD 2440328..2440765 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=678748 MYE78_RS11660 WP_032874029.1 2435711..2435884(+) (sinI) [Bacillus velezensis strain EM-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=678748 MYE78_RS11660 WP_032874029.1 2435711..2435884(+) (sinI) [Bacillus velezensis strain EM-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719