Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   MXH98_RS11725 Genome accession   NZ_CP095760
Coordinates   2426973..2427410 (-) Length   145 a.a.
NCBI ID   WP_012117983.1    Uniprot ID   -
Organism   Bacillus velezensis strain ZK-3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2421973..2432410
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MXH98_RS11675 (MXH98_11675) sinI 2422357..2422530 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  MXH98_RS11680 (MXH98_11680) sinR 2422564..2422899 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MXH98_RS11685 (MXH98_11685) - 2422947..2423732 (-) 786 WP_007408329.1 TasA family protein -
  MXH98_RS11690 (MXH98_11690) - 2423797..2424381 (-) 585 WP_012117977.1 signal peptidase I -
  MXH98_RS11695 (MXH98_11695) tapA 2424353..2425024 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  MXH98_RS11700 (MXH98_11700) - 2425283..2425612 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  MXH98_RS11705 (MXH98_11705) - 2425652..2425831 (-) 180 WP_003153093.1 YqzE family protein -
  MXH98_RS11710 (MXH98_11710) comGG 2425888..2426265 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  MXH98_RS11715 (MXH98_11715) comGF 2426266..2426766 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  MXH98_RS11720 (MXH98_11720) comGE 2426675..2426989 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  MXH98_RS11725 (MXH98_11725) comGD 2426973..2427410 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  MXH98_RS11730 (MXH98_11730) comGC 2427400..2427708 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  MXH98_RS11735 (MXH98_11735) comGB 2427713..2428750 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  MXH98_RS11740 (MXH98_11740) comGA 2428737..2429807 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  MXH98_RS11745 (MXH98_11745) - 2430004..2430953 (-) 950 Protein_2270 magnesium transporter CorA family protein -
  MXH98_RS11750 (MXH98_11750) - 2431099..2432400 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16286.74 Da        Isoelectric Point: 10.2475

>NTDB_id=678175 MXH98_RS11725 WP_012117983.1 2426973..2427410(-) (comGD) [Bacillus velezensis strain ZK-3]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=678175 MXH98_RS11725 WP_012117983.1 2426973..2427410(-) (comGD) [Bacillus velezensis strain ZK-3]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACGGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572