Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MXH98_RS11675 Genome accession   NZ_CP095760
Coordinates   2422357..2422530 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain ZK-3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2417357..2427530
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MXH98_RS11660 (MXH98_11660) gcvT 2418170..2419270 (-) 1101 WP_012117974.1 glycine cleavage system aminomethyltransferase GcvT -
  MXH98_RS11665 (MXH98_11665) - 2419694..2421364 (+) 1671 WP_012117975.1 SNF2-related protein -
  MXH98_RS11670 (MXH98_11670) - 2421386..2422180 (+) 795 WP_012117976.1 YqhG family protein -
  MXH98_RS11675 (MXH98_11675) sinI 2422357..2422530 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  MXH98_RS11680 (MXH98_11680) sinR 2422564..2422899 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MXH98_RS11685 (MXH98_11685) - 2422947..2423732 (-) 786 WP_007408329.1 TasA family protein -
  MXH98_RS11690 (MXH98_11690) - 2423797..2424381 (-) 585 WP_012117977.1 signal peptidase I -
  MXH98_RS11695 (MXH98_11695) tapA 2424353..2425024 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  MXH98_RS11700 (MXH98_11700) - 2425283..2425612 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  MXH98_RS11705 (MXH98_11705) - 2425652..2425831 (-) 180 WP_003153093.1 YqzE family protein -
  MXH98_RS11710 (MXH98_11710) comGG 2425888..2426265 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  MXH98_RS11715 (MXH98_11715) comGF 2426266..2426766 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  MXH98_RS11720 (MXH98_11720) comGE 2426675..2426989 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  MXH98_RS11725 (MXH98_11725) comGD 2426973..2427410 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=678172 MXH98_RS11675 WP_003153105.1 2422357..2422530(+) (sinI) [Bacillus velezensis strain ZK-3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=678172 MXH98_RS11675 WP_003153105.1 2422357..2422530(+) (sinI) [Bacillus velezensis strain ZK-3]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702