Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MX663_RS13405 Genome accession   NZ_CP095736
Coordinates   2561452..2561625 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain N4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2556452..2566625
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MX663_RS13390 (MX663_13390) gcvT 2557252..2558340 (-) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -
  MX663_RS13395 (MX663_13395) yqhH 2558781..2560454 (+) 1674 WP_003230203.1 SNF2-related protein -
  MX663_RS13400 (MX663_13400) yqhG 2560475..2561269 (+) 795 WP_003230200.1 YqhG family protein -
  MX663_RS13405 (MX663_13405) sinI 2561452..2561625 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  MX663_RS13410 (MX663_13410) sinR 2561659..2561994 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MX663_RS13415 (MX663_13415) tasA 2562087..2562872 (-) 786 WP_161476870.1 biofilm matrix protein TasA -
  MX663_RS13420 (MX663_13420) sipW 2562936..2563508 (-) 573 WP_003230181.1 signal peptidase I -
  MX663_RS13425 (MX663_13425) tapA 2563492..2564253 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  MX663_RS13430 (MX663_13430) yqzG 2564525..2564851 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MX663_RS13435 (MX663_13435) spoIIT 2564893..2565072 (-) 180 WP_029726723.1 YqzE family protein -
  MX663_RS13440 (MX663_13440) comGG 2565144..2565518 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  MX663_RS13445 (MX663_13445) comGF 2565519..2565902 (-) 384 WP_080529536.1 ComG operon protein ComGF Machinery gene
  MX663_RS13450 (MX663_13450) comGE 2565928..2566275 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=677864 MX663_RS13405 WP_003230187.1 2561452..2561625(+) (sinI) [Bacillus subtilis strain N4]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=677864 MX663_RS13405 WP_003230187.1 2561452..2561625(+) (sinI) [Bacillus subtilis strain N4]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1