Detailed information    

insolico Bioinformatically predicted

Overview

Name   dprA   Type   Machinery gene
Locus tag   JMUB0001_RS07660 Genome accession   NZ_AP014956
Coordinates   1599596..1600468 (-) Length   290 a.a.
NCBI ID   WP_002436358.1    Uniprot ID   -
Organism   Staphylococcus capitis strain TW2795     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1554128..1617875 1599596..1600468 within 0


Gene organization within MGE regions


Location: 1554128..1617875
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JMUB0001_RS07480 (JMUB0001_1462) recA 1555688..1556740 (-) 1053 WP_002437037.1 recombinase RecA Machinery gene
  JMUB0001_RS07485 (JMUB0001_1463) - 1556909..1558057 (-) 1149 WP_030064817.1 CinA family nicotinamide mononucleotide deamidase-related protein -
  JMUB0001_RS07490 (JMUB0001_1464) pgsA 1558199..1558780 (-) 582 WP_002469863.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  JMUB0001_RS07495 (JMUB0001_1465) - 1558808..1559200 (-) 393 WP_030064815.1 helix-turn-helix domain-containing protein -
  JMUB0001_RS07500 (JMUB0001_1466) - 1559219..1560046 (-) 828 WP_030064813.1 YmfK family protein -
  JMUB0001_RS07505 (JMUB0001_1467) - 1560204..1560911 (-) 708 WP_023350378.1 SDR family NAD(P)-dependent oxidoreductase -
  JMUB0001_RS07510 (JMUB0001_1468) - 1560911..1562197 (-) 1287 WP_030064811.1 pitrilysin family protein -
  JMUB0001_RS07515 (JMUB0001_1469) - 1562197..1563471 (-) 1275 WP_030064809.1 pitrilysin family protein -
  JMUB0001_RS07520 (JMUB0001_1470) - 1563513..1564223 (-) 711 WP_002436349.1 GntR family transcriptional regulator -
  JMUB0001_RS07525 (JMUB0001_1471) - 1564226..1566646 (-) 2421 WP_023350382.1 DNA translocase FtsK -
  JMUB0001_RS07530 (JMUB0001_1472) - 1566904..1568577 (-) 1674 WP_002469869.1 ribonuclease J -
  JMUB0001_RS07535 (JMUB0001_1473) pnp 1568811..1570910 (-) 2100 WP_030064806.1 polyribonucleotide nucleotidyltransferase -
  JMUB0001_RS07540 (JMUB0001_1474) rpsO 1571228..1571497 (-) 270 WP_002436359.1 30S ribosomal protein S15 -
  JMUB0001_RS07545 (JMUB0001_1475) ribF 1571619..1572590 (-) 972 WP_002436322.1 riboflavin biosynthesis protein RibF -
  JMUB0001_RS07550 (JMUB0001_1476) truB 1572606..1573523 (-) 918 WP_002436304.1 tRNA pseudouridine(55) synthase TruB -
  JMUB0001_RS07555 (JMUB0001_1477) rbfA 1573672..1574022 (-) 351 WP_002436301.1 30S ribosome-binding factor RbfA -
  JMUB0001_RS07560 (JMUB0001_1478) infB 1574179..1576344 (-) 2166 WP_030064804.1 translation initiation factor IF-2 -
  JMUB0001_RS07565 (JMUB0001_1479) - 1576349..1576666 (-) 318 WP_030064802.1 ribosomal L7Ae/L30e/S12e/Gadd45 family protein -
  JMUB0001_RS07570 (JMUB0001_1480) - 1576663..1576947 (-) 285 WP_002436310.1 YlxR family protein -
  JMUB0001_RS07575 (JMUB0001_1481) nusA 1576964..1578187 (-) 1224 WP_002436342.1 transcription termination factor NusA -
  JMUB0001_RS07580 (JMUB0001_1482) rimP 1578208..1578675 (-) 468 WP_002436317.1 ribosome maturation factor RimP -
  JMUB0001_RS07585 (JMUB0001_1483) - 1578901..1583211 (-) 4311 WP_096389449.1 PolC-type DNA polymerase III -
  JMUB0001_RS07590 (JMUB0001_1484) - 1583467..1585170 (-) 1704 WP_096389322.1 proline--tRNA ligase -
  JMUB0001_RS07595 (JMUB0001_1485) rseP 1585190..1586476 (-) 1287 WP_030064796.1 RIP metalloprotease RseP -
  JMUB0001_RS07600 (JMUB0001_1486) - 1586716..1587498 (-) 783 WP_002436308.1 phosphatidate cytidylyltransferase -
  JMUB0001_RS07605 (JMUB0001_1487) - 1587502..1588272 (-) 771 WP_002436351.1 isoprenyl transferase -
  JMUB0001_RS07610 (JMUB0001_1488) frr 1588553..1589107 (-) 555 WP_002436295.1 ribosome recycling factor -
  JMUB0001_RS07615 (JMUB0001_1489) pyrH 1589125..1589847 (-) 723 WP_002436299.1 UMP kinase -
  JMUB0001_RS07620 (JMUB0001_1490) tsf 1589984..1590862 (-) 879 WP_030064793.1 translation elongation factor Ts -
  JMUB0001_RS07625 (JMUB0001_1491) rpsB 1591013..1591801 (-) 789 WP_002436327.1 30S ribosomal protein S2 -
  JMUB0001_RS07630 (JMUB0001_1492) codY 1592054..1592827 (-) 774 WP_002436324.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  JMUB0001_RS07635 (JMUB0001_1493) hslU 1592850..1594253 (-) 1404 WP_002436320.1 ATP-dependent protease ATPase subunit HslU -
  JMUB0001_RS07640 (JMUB0001_1494) hslV 1594337..1594879 (-) 543 WP_023350393.1 ATP-dependent protease subunit HslV -
  JMUB0001_RS07645 (JMUB0001_1495) xerC 1594883..1595773 (-) 891 WP_023350394.1 tyrosine recombinase XerC -
  JMUB0001_RS07650 (JMUB0001_1496) trmFO 1596010..1597317 (-) 1308 WP_030064791.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  JMUB0001_RS07655 (JMUB0001_1497) topA 1597343..1599418 (-) 2076 WP_030064789.1 type I DNA topoisomerase -
  JMUB0001_RS07660 (JMUB0001_1498) dprA 1599596..1600468 (-) 873 WP_002436358.1 DNA-processing protein DprA Machinery gene
  JMUB0001_RS07665 (JMUB0001_1499) sucD 1600694..1601602 (-) 909 WP_002436344.1 succinate--CoA ligase subunit alpha -
  JMUB0001_RS07670 (JMUB0001_1500) sucC 1601624..1602790 (-) 1167 WP_002436291.1 ADP-forming succinate--CoA ligase subunit beta -
  JMUB0001_RS07675 (JMUB0001_1501) - 1602898..1603668 (-) 771 WP_030064786.1 ribonuclease HII -
  JMUB0001_RS07680 (JMUB0001_1502) ylqF 1603652..1604535 (-) 884 Protein_1466 ribosome biogenesis GTPase YlqF -
  JMUB0001_RS07685 (JMUB0001_1503) - 1604815..1607415 (+) 2601 WP_096389324.1 YfhO family protein -
  JMUB0001_RS07690 (JMUB0001_1504) - 1607408..1610020 (+) 2613 WP_030064780.1 YfhO family protein -
  JMUB0001_RS07695 (JMUB0001_1505) - 1610460..1610699 (+) 240 WP_228116314.1 hypothetical protein -
  JMUB0001_RS07700 (JMUB0001_1506) - 1610739..1611077 (+) 339 WP_030064776.1 hypothetical protein -
  JMUB0001_RS07705 (JMUB0001_1507) rplS 1611654..1612004 (-) 351 WP_002436293.1 50S ribosomal protein L19 -
  JMUB0001_RS07710 (JMUB0001_1508) trmD 1612110..1612847 (-) 738 WP_030064770.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  JMUB0001_RS07715 (JMUB0001_1509) rimM 1612847..1613350 (-) 504 WP_030064768.1 ribosome maturation factor RimM -
  JMUB0001_RS07720 (JMUB0001_1510) rpsP 1613613..1613888 (-) 276 WP_002453071.1 30S ribosomal protein S16 -
  JMUB0001_RS07725 (JMUB0001_1511) ffh 1614375..1615742 (-) 1368 WP_002435148.1 signal recognition particle protein -
  JMUB0001_RS07730 (JMUB0001_1512) - 1615772..1616104 (-) 333 WP_002435170.1 putative DNA-binding protein -
  JMUB0001_RS07735 (JMUB0001_1513) ftsY 1616091..1617350 (-) 1260 WP_030064764.1 signal recognition particle-docking protein FtsY -

Sequence

Protein


Download         Length: 290 a.a.        Molecular weight: 33396.67 Da        Isoelectric Point: 9.6697

>NTDB_id=67550 JMUB0001_RS07660 WP_002436358.1 1599596..1600468(-) (dprA) [Staphylococcus capitis strain TW2795]
MIQHTLLKLYWANFATTQVHQFIKEYPEVISENALIQNEMIEDWAKRQTSSTVRRKLSLFKSLNTEVIFQEMTKMNLKYL
TYFDKHYPQLLKEIYDFPYVIFYKGNKQLFNCPHTLAVIGSRKSTLYTTQALEYLFPSFKSLKMTIISGLAYGADSIAHQ
VALKNKLPTIGVLGFGHSYHYPKSSLKTRENIERKGLVISEYPPHSPITRYKFPERNRLISGLARGLLITEAEKISGSQI
TVDCALEQNRNVYVLPGSMFNPMTKSNLLRLQEGAQVVLDESSILSDYIF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=67550 JMUB0001_RS07660 WP_002436358.1 1599596..1600468(-) (dprA) [Staphylococcus capitis strain TW2795]
GTGATTCAACACACTTTATTGAAGCTCTATTGGGCTAATTTCGCCACAACGCAAGTTCATCAATTTATTAAAGAATATCC
AGAAGTTATTTCAGAAAATGCACTAATTCAAAATGAGATGATTGAGGATTGGGCTAAAAGACAAACCTCATCCACAGTCA
GGAGAAAATTGAGCTTATTTAAATCACTTAATACAGAAGTTATATTTCAAGAAATGACTAAAATGAACCTCAAATATTTA
ACTTACTTTGACAAACATTATCCTCAATTACTTAAAGAAATTTATGATTTCCCATATGTAATTTTTTATAAAGGAAATAA
ACAACTATTTAATTGTCCTCATACTTTAGCTGTTATAGGCTCAAGAAAGTCAACTTTATATACAACTCAAGCTTTGGAAT
ACCTTTTCCCATCATTTAAATCACTGAAAATGACGATTATTTCCGGATTAGCATATGGTGCAGATAGTATAGCTCACCAA
GTCGCACTAAAAAATAAACTTCCAACAATAGGTGTTCTTGGCTTCGGCCATTCATATCATTATCCTAAATCATCTTTAAA
GACAAGAGAGAATATCGAACGAAAAGGACTAGTTATAAGTGAGTATCCACCTCATTCTCCCATAACCAGATATAAATTTC
CTGAAAGAAATAGATTGATTAGTGGACTCGCTCGGGGTCTATTAATTACAGAAGCAGAGAAAATAAGCGGTAGTCAAATA
ACAGTAGACTGCGCTTTAGAACAAAACCGGAATGTATATGTTTTACCAGGATCAATGTTTAATCCTATGACCAAAAGTAA
TTTACTTAGACTTCAAGAGGGGGCACAAGTCGTTTTAGATGAAAGTAGTATTCTTTCAGACTACATTTTCTAA

Domains

Predicted by InterproScan.

DNA recombination-mediator protein A (DNA_processg_A)

(72-279)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus N315

59.028

99.31

0.586
  dprA Staphylococcus aureus MW2

59.028

99.31

0.586

Multiple sequence alignment