Detailed information    

insolico Bioinformatically predicted

Overview

Name   dprA   Type   Machinery gene
Locus tag   MUA44_RS07935 Genome accession   NZ_CP094740
Coordinates   1666555..1667442 (-) Length   295 a.a.
NCBI ID   WP_262612492.1    Uniprot ID   -
Organism   Staphylococcus delphini strain IVB6190     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1601769..1697292 1666555..1667442 within 0


Gene organization within MGE regions


Location: 1601769..1697292
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MUA44_RS07675 (MUA44_07665) mutS 1603547..1606144 (-) 2598 WP_262616001.1 DNA mismatch repair protein MutS -
  MUA44_RS07680 (MUA44_07670) thiW 1607665..1608174 (-) 510 WP_096540871.1 energy coupling factor transporter S component ThiW -
  MUA44_RS07685 (MUA44_07675) - 1608229..1608606 (-) 378 WP_096593188.1 YlbF family regulator -
  MUA44_RS07690 (MUA44_07680) miaB 1608607..1610157 (-) 1551 WP_262612468.1 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB -
  MUA44_RS07695 (MUA44_07685) - 1610261..1610560 (-) 300 WP_019165438.1 MTH1187 family thiamine-binding protein -
  MUA44_RS07700 (MUA44_07690) - 1610820..1611686 (-) 867 WP_019165439.1 2-oxoacid:ferredoxin oxidoreductase subunit beta -
  MUA44_RS07705 (MUA44_07695) - 1611687..1613447 (-) 1761 WP_262612469.1 2-oxoacid:acceptor oxidoreductase subunit alpha -
  MUA44_RS07710 (MUA44_07700) - 1613600..1614394 (-) 795 WP_262612470.1 TIGR00282 family metallophosphoesterase -
  MUA44_RS07715 (MUA44_07705) - 1614724..1616898 (-) 2175 WP_262613644.1 heavy metal translocating P-type ATPase -
  MUA44_RS07720 (MUA44_07710) - 1616882..1617262 (-) 381 WP_262612471.1 metalloregulator ArsR/SmtB family transcription factor -
  MUA44_RS07725 (MUA44_07715) - 1617461..1617679 (+) 219 WP_019165444.1 hypothetical protein -
  MUA44_RS07730 (MUA44_07720) rny 1617802..1619361 (-) 1560 WP_019165445.1 ribonuclease Y -
  MUA44_RS07735 (MUA44_07725) recA 1619588..1620631 (-) 1044 WP_262612472.1 recombinase RecA Machinery gene
  MUA44_RS07740 (MUA44_07730) - 1620770..1621945 (-) 1176 WP_262612473.1 CinA family nicotinamide mononucleotide deamidase-related protein -
  MUA44_RS07745 (MUA44_07735) pgsA 1622168..1622752 (-) 585 WP_262612474.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  MUA44_RS07750 (MUA44_07740) - 1622794..1623189 (-) 396 WP_262612475.1 RodZ family helix-turn-helix domain-containing protein -
  MUA44_RS07755 (MUA44_07745) - 1623209..1624054 (-) 846 WP_014614053.1 DUF3388 domain-containing protein -
  MUA44_RS07760 (MUA44_07750) ymfI 1624111..1624815 (-) 705 WP_262612476.1 elongation factor P 5-aminopentanone reductase -
  MUA44_RS07765 (MUA44_07755) yfmH 1624812..1626101 (-) 1290 WP_262612477.1 EF-P 5-aminopentanol modification-associated protein YfmH -
  MUA44_RS07770 (MUA44_07760) yfmF 1626094..1627368 (-) 1275 WP_262616002.1 EF-P 5-aminopentanol modification-associated protein YfmF -
  MUA44_RS07775 (MUA44_07765) - 1627402..1628118 (-) 717 WP_014614057.1 GntR family transcriptional regulator -
  MUA44_RS07780 (MUA44_07770) - 1628124..1630502 (-) 2379 WP_262612479.1 DNA translocase FtsK -
  MUA44_RS07785 (MUA44_07775) rnjB 1630640..1632313 (-) 1674 WP_262612480.1 ribonuclease J2 -
  MUA44_RS07790 (MUA44_07780) pnp 1632822..1634915 (-) 2094 WP_019165455.1 polyribonucleotide nucleotidyltransferase -
  MUA44_RS07795 (MUA44_07785) rpsO 1635074..1635343 (-) 270 WP_014614062.1 30S ribosomal protein S15 -
  MUA44_RS07800 (MUA44_07790) ribF 1635444..1636415 (-) 972 WP_262612481.1 riboflavin biosynthesis protein RibF -
  MUA44_RS07805 (MUA44_07795) truB 1636430..1637347 (-) 918 WP_019165457.1 tRNA pseudouridine(55) synthase TruB -
  MUA44_RS07810 (MUA44_07800) rbfA 1637432..1637776 (-) 345 WP_014614065.1 30S ribosome-binding factor RbfA -
  MUA44_RS07815 (MUA44_07805) - 1638392..1639252 (-) 861 WP_316957948.1 IS3 family transposase -
  MUA44_RS07820 (MUA44_07810) - 1639252..1639539 (-) 288 WP_096591494.1 transposase -
  MUA44_RS07825 (MUA44_07815) - 1639964..1640203 (-) 240 WP_262612482.1 hypothetical protein -
  MUA44_RS07830 (MUA44_07820) infB 1640421..1642562 (-) 2142 WP_262612483.1 translation initiation factor IF-2 -
  MUA44_RS07835 (MUA44_07825) - 1642579..1642884 (-) 306 WP_160215586.1 ribosomal L7Ae/L30e/S12e/Gadd45 family protein -
  MUA44_RS07840 (MUA44_07830) rnpM 1642881..1643168 (-) 288 WP_019165466.1 RNase P modulator RnpM -
  MUA44_RS07845 (MUA44_07835) nusA 1643180..1644358 (-) 1179 WP_096554960.1 transcription termination factor NusA -
  MUA44_RS07850 (MUA44_07840) rimP 1644379..1644846 (-) 468 WP_262612484.1 ribosome maturation factor RimP -
  MUA44_RS07855 (MUA44_07845) - 1644971..1649233 (-) 4263 WP_394356360.1 PolC-type DNA polymerase III -
  MUA44_RS07860 (MUA44_07850) - 1649952..1651655 (-) 1704 WP_262612486.1 proline--tRNA ligase -
  MUA44_RS07865 (MUA44_07855) rseP 1651680..1652960 (-) 1281 WP_096540779.1 RIP metalloprotease RseP -
  MUA44_RS07870 (MUA44_07860) - 1652967..1654097 (-) 1131 WP_262616210.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  MUA44_RS07875 (MUA44_07865) - 1654114..1654896 (-) 783 WP_262612487.1 phosphatidate cytidylyltransferase -
  MUA44_RS07880 (MUA44_07870) - 1654911..1655672 (-) 762 WP_019165473.1 isoprenyl transferase -
  MUA44_RS07885 (MUA44_07875) frr 1655916..1656470 (-) 555 WP_019165474.1 ribosome recycling factor -
  MUA44_RS07890 (MUA44_07880) pyrH 1656488..1657210 (-) 723 WP_019165475.1 UMP kinase -
  MUA44_RS07895 (MUA44_07885) tsf 1657361..1658239 (-) 879 WP_014614081.1 translation elongation factor Ts -
  MUA44_RS07900 (MUA44_07890) rpsB 1658330..1659127 (-) 798 WP_014614082.1 30S ribosomal protein S2 -
  MUA44_RS07905 (MUA44_07895) codY 1659294..1660067 (-) 774 WP_019165476.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  MUA44_RS07910 (MUA44_07900) hslU 1660087..1661496 (-) 1410 WP_096545870.1 ATP-dependent protease ATPase subunit HslU -
  MUA44_RS07915 (MUA44_07905) hslV 1661511..1662053 (-) 543 WP_019165478.1 ATP-dependent protease subunit HslV -
  MUA44_RS07920 (MUA44_07910) xerC 1662060..1662920 (-) 861 WP_394356361.1 tyrosine recombinase XerC -
  MUA44_RS07925 (MUA44_07915) trmFO 1663070..1664374 (-) 1305 WP_096554981.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  MUA44_RS07930 (MUA44_07920) topA 1664402..1666471 (-) 2070 WP_262612491.1 type I DNA topoisomerase -
  MUA44_RS07935 (MUA44_07925) dprA 1666555..1667442 (-) 888 WP_262612492.1 DNA-processing protein DprA Machinery gene
  MUA44_RS07940 (MUA44_07930) sucD 1667685..1668590 (-) 906 WP_086427944.1 succinate--CoA ligase subunit alpha -
  MUA44_RS07945 (MUA44_07935) sucC 1668612..1669778 (-) 1167 WP_019165484.1 ADP-forming succinate--CoA ligase subunit beta -
  MUA44_RS07950 (MUA44_07940) - 1670666..1670941 (-) 276 WP_019165485.1 hypothetical protein -
  MUA44_RS07955 (MUA44_07945) - 1671033..1671818 (-) 786 WP_262612493.1 ribonuclease HII -
  MUA44_RS07960 (MUA44_07950) ylqF 1671811..1672683 (-) 873 WP_262612494.1 ribosome biogenesis GTPase YlqF -
  MUA44_RS07965 (MUA44_07955) - 1672911..1673294 (+) 384 WP_096593260.1 GtrA family protein -
  MUA44_RS07970 (MUA44_07960) - 1673314..1675923 (+) 2610 WP_262616003.1 YfhO family protein -
  MUA44_RS07975 (MUA44_07965) - 1675920..1678508 (+) 2589 WP_262612496.1 YfhO family protein -
  MUA44_RS07980 (MUA44_07970) - 1678740..1679372 (+) 633 WP_262612497.1 hypothetical protein -
  MUA44_RS07985 (MUA44_07975) - 1679659..1679796 (+) 138 WP_014614102.1 beta-class phenol-soluble modulin -
  MUA44_RS07990 (MUA44_07980) rplS 1680064..1680414 (-) 351 WP_014614103.1 50S ribosomal protein L19 -
  MUA44_RS07995 (MUA44_07985) trmD 1680522..1681253 (-) 732 WP_262612498.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  MUA44_RS08000 (MUA44_07990) rimM 1681250..1681753 (-) 504 WP_262612499.1 ribosome maturation factor RimM -
  MUA44_RS08005 (MUA44_07995) rpsP 1682076..1682351 (-) 276 WP_014614106.1 30S ribosomal protein S16 -
  MUA44_RS08010 (MUA44_08000) - 1682620..1682880 (-) 261 WP_241519955.1 hypothetical protein -
  MUA44_RS08015 (MUA44_08005) - 1683073..1683291 (-) 219 WP_262612500.1 hypothetical protein -
  MUA44_RS08020 (MUA44_08010) - 1683360..1684571 (-) 1212 WP_262612501.1 restriction endonuclease subunit S -
  MUA44_RS08025 (MUA44_08015) - 1684564..1686120 (-) 1557 WP_262612502.1 type I restriction-modification system subunit M -
  MUA44_RS08030 (MUA44_08020) - 1686715..1689507 (-) 2793 Protein_1554 type I restriction endonuclease subunit R -
  MUA44_RS08035 (MUA44_08025) ffh 1691419..1692786 (-) 1368 WP_019165648.1 signal recognition particle protein -
  MUA44_RS08040 (MUA44_08030) - 1692800..1693135 (-) 336 WP_019168918.1 putative DNA-binding protein -
  MUA44_RS08045 (MUA44_08035) ftsY 1693139..1694338 (-) 1200 WP_096555787.1 signal recognition particle-docking protein FtsY -

Sequence

Protein


Download         Length: 295 a.a.        Molecular weight: 33330.69 Da        Isoelectric Point: 7.6657

>NTDB_id=671703 MUA44_RS07935 WP_262612492.1 1666555..1667442(-) (dprA) [Staphylococcus delphini strain IVB6190]
MKQLLLLLLYAGFSTQQLQSYYPKLCALTGNLPQRIQAFKSMVSHMTPSHIQQKLVRLDSLNIHTIEAALHEHQIVPIMI
DEPFYPPLLKEIYDPPLILFCKGRLELLQHSANSLGIVGARQHTAYTPQALEILFNSFQYFPLTIISGLAHGTDALAHHC
AIRHDLSTIGVLGFGHFHHYPKDTQALRQTMEQHHLTISEYPPHTPIAKFRFPERNRMISGLSKGILITEAKEKSGALIT
LDQALEQNRNVYVLPGDMFNVHTKGNMLRVKEGAEIVLCAQDILKDYAFLNDNAL

Nucleotide


Download         Length: 888 bp        

>NTDB_id=671703 MUA44_RS07935 WP_262612492.1 1666555..1667442(-) (dprA) [Staphylococcus delphini strain IVB6190]
ATGAAACAATTGCTACTATTATTATTGTACGCTGGATTTTCAACACAACAACTCCAATCCTACTATCCTAAACTTTGTGC
TTTGACAGGAAACTTACCTCAGCGCATTCAAGCCTTCAAATCAATGGTTTCACACATGACGCCATCTCATATTCAACAAA
AGCTCGTACGCCTCGATTCGCTCAATATTCATACGATTGAAGCGGCGTTACATGAACACCAAATTGTCCCGATTATGATA
GACGAACCGTTTTATCCGCCGTTGTTGAAAGAAATTTATGATCCCCCTTTGATTTTGTTTTGTAAAGGACGACTCGAATT
GCTGCAACATTCTGCAAACAGTCTTGGCATTGTAGGTGCAAGACAACATACAGCATACACGCCACAAGCACTCGAAATAC
TTTTTAACTCATTTCAATATTTTCCACTGACTATAATTTCAGGACTGGCACACGGCACAGACGCATTGGCACATCATTGC
GCGATTCGACATGACTTGTCCACGATTGGGGTGCTCGGCTTTGGGCATTTTCATCATTATCCGAAAGACACACAAGCATT
ACGCCAAACGATGGAACAACATCATTTGACTATAAGCGAATATCCGCCACATACGCCTATTGCTAAATTTAGATTTCCTG
AACGCAACCGCATGATTAGTGGTTTGTCGAAAGGGATACTCATCACTGAAGCAAAAGAAAAAAGTGGTGCGCTCATTACG
TTGGATCAGGCATTAGAACAAAATCGTAACGTTTATGTACTGCCGGGGGATATGTTTAATGTGCATACGAAAGGCAATAT
GCTACGGGTCAAAGAGGGCGCAGAAATTGTATTATGTGCCCAAGATATCTTGAAGGATTATGCGTTTTTAAATGATAATG
CTTTGTGA

Domains

Predicted by InterproScan.

DNA recombination-mediator protein A (DNA_processg_A)

(72-278)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus MW2

50.69

98.305

0.498
  dprA Staphylococcus aureus N315

50.345

98.305

0.495