Detailed information    

insolico Bioinformatically predicted

Overview

Name   comK/comK1   Type   Regulator
Locus tag   MUA15_RS09005 Genome accession   NZ_CP094733
Coordinates   1895592..1896167 (-) Length   191 a.a.
NCBI ID   WP_001829272.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain IVB6194     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1851734..1895190 1895592..1896167 flank 402


Gene organization within MGE regions


Location: 1851734..1896167
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MUA15_RS08655 (MUA15_08630) - 1851734..1852894 (-) 1161 WP_001830282.1 hypothetical protein -
  MUA15_RS08660 (MUA15_08635) - 1852961..1854343 (-) 1383 WP_001830263.1 N-acetylmuramoyl-L-alanine amidase -
  MUA15_RS08665 (MUA15_08640) - 1854343..1854609 (-) 267 WP_001830297.1 phage holin -
  MUA15_RS08670 (MUA15_08645) - 1854659..1855186 (-) 528 WP_001830238.1 hypothetical protein -
  MUA15_RS08675 (MUA15_08650) - 1855186..1855695 (-) 510 WP_012099596.1 hypothetical protein -
  MUA15_RS08680 (MUA15_08655) - 1855748..1857538 (-) 1791 WP_262619575.1 glucosaminidase domain-containing protein -
  MUA15_RS08685 (MUA15_08660) - 1858034..1858333 (-) 300 WP_001830303.1 DUF2951 family protein -
  MUA15_RS08690 (MUA15_08665) - 1858370..1858510 (-) 141 WP_001830255.1 XkdX family protein -
  MUA15_RS08695 (MUA15_08670) - 1858512..1858850 (-) 339 WP_001830258.1 hypothetical protein -
  MUA15_RS08700 (MUA15_08675) - 1858855..1860387 (-) 1533 WP_262619577.1 BppU family phage baseplate upper protein -
  MUA15_RS08705 (MUA15_08680) - 1860387..1863053 (-) 2667 WP_262619578.1 peptidase G2 autoproteolytic cleavage domain-containing protein -
  MUA15_RS08710 (MUA15_08685) - 1863068..1864924 (-) 1857 WP_001830292.1 SGNH/GDSL hydrolase family protein -
  MUA15_RS08715 (MUA15_08690) - 1864938..1865876 (-) 939 WP_064634349.1 phage tail domain-containing protein -
  MUA15_RS08720 (MUA15_08695) - 1865892..1868996 (-) 3105 WP_262619579.1 terminase -
  MUA15_RS08725 (MUA15_08700) - 1868999..1869301 (-) 303 WP_015984396.1 hypothetical protein -
  MUA15_RS08730 (MUA15_08705) - 1869364..1869858 (-) 495 WP_015984395.1 tail assembly chaperone -
  MUA15_RS08735 (MUA15_08710) - 1869921..1870460 (-) 540 WP_002456898.1 tail protein -
  MUA15_RS08740 (MUA15_08715) - 1870447..1870884 (-) 438 WP_015984394.1 DUF3168 domain-containing protein -
  MUA15_RS08745 (MUA15_08720) - 1870897..1871055 (-) 159 Protein_1691 HK97 gp10 family phage protein -
  MUA15_RS08750 (MUA15_08725) - 1871247..1871930 (-) 684 WP_044593021.1 hypothetical protein -
  MUA15_RS08755 (MUA15_08730) - 1872059..1872313 (-) 255 Protein_1693 HK97 gp10 family phage protein -
  MUA15_RS08760 (MUA15_08735) - 1872306..1872635 (-) 330 WP_089424042.1 phage head closure protein -
  MUA15_RS08765 (MUA15_08740) - 1872628..1872942 (-) 315 WP_237632778.1 phage head-tail connector protein -
  MUA15_RS08770 (MUA15_08745) - 1872942..1873232 (-) 291 WP_089424040.1 Rho termination factor N-terminal domain-containing protein -
  MUA15_RS08775 (MUA15_08750) - 1873249..1874064 (-) 816 WP_262619581.1 N4-gp56 family major capsid protein -
  MUA15_RS08780 (MUA15_08755) - 1874082..1874675 (-) 594 WP_064658444.1 phage scaffolding protein -
  MUA15_RS08785 (MUA15_08760) - 1874769..1875716 (-) 948 WP_107506526.1 phage head morphogenesis protein -
  MUA15_RS08790 (MUA15_08765) - 1875673..1877109 (-) 1437 WP_262619582.1 phage portal protein -
  MUA15_RS08795 (MUA15_08770) - 1877115..1878380 (-) 1266 WP_002504353.1 PBSX family phage terminase large subunit -
  MUA15_RS08800 (MUA15_08775) - 1878364..1878744 (-) 381 WP_002469473.1 phBC6A51 family helix-turn-helix protein -
  MUA15_RS08805 (MUA15_08780) - 1879262..1879678 (-) 417 WP_262619583.1 transcriptional regulator -
  MUA15_RS08810 (MUA15_08785) - 1879696..1879914 (-) 219 WP_001830276.1 hypothetical protein -
  MUA15_RS08815 (MUA15_08790) - 1879918..1880058 (-) 141 WP_001830302.1 hypothetical protein -
  MUA15_RS08820 (MUA15_08795) - 1880046..1880444 (-) 399 WP_002468964.1 hypothetical protein -
  MUA15_RS08825 (MUA15_08800) rinB 1880446..1880616 (-) 171 WP_107523037.1 transcriptional activator RinB -
  MUA15_RS08830 (MUA15_08805) - 1880721..1881023 (+) 303 WP_262619584.1 DUF4870 domain-containing protein -
  MUA15_RS08835 (MUA15_08810) - 1881114..1881437 (-) 324 WP_016050563.1 MazG-like family protein -
  MUA15_RS08840 (MUA15_08815) - 1881585..1881821 (-) 237 WP_001830278.1 hypothetical protein -
  MUA15_RS08845 - 1881852..1881986 (-) 135 WP_256322765.1 hypothetical protein -
  MUA15_RS08850 (MUA15_08820) - 1881976..1882203 (-) 228 WP_262619585.1 hypothetical protein -
  MUA15_RS08855 (MUA15_08825) - 1882193..1882489 (-) 297 WP_262619586.1 hypothetical protein -
  MUA15_RS08860 (MUA15_08830) - 1882473..1882673 (-) 201 WP_262619587.1 hypothetical protein -
  MUA15_RS08865 (MUA15_08835) - 1882660..1883274 (-) 615 WP_237632792.1 HNH endonuclease signature motif containing protein -
  MUA15_RS08870 (MUA15_08840) - 1883280..1883510 (-) 231 WP_001830240.1 hypothetical protein -
  MUA15_RS08875 (MUA15_08845) - 1883515..1883958 (-) 444 WP_262619588.1 DUF3310 domain-containing protein -
  MUA15_RS08880 (MUA15_08850) - 1883955..1884314 (-) 360 WP_002470860.1 SA1788 family PVL leukocidin-associated protein -
  MUA15_RS08885 (MUA15_08855) - 1884315..1884506 (-) 192 WP_002456379.1 hypothetical protein -
  MUA15_RS08890 (MUA15_08860) - 1884506..1884880 (-) 375 WP_002470844.1 hypothetical protein -
  MUA15_RS08895 (MUA15_08865) - 1884867..1885283 (-) 417 WP_002470845.1 DUF1064 domain-containing protein -
  MUA15_RS08900 (MUA15_08870) - 1885294..1885518 (-) 225 WP_002456377.1 DUF3269 family protein -
  MUA15_RS08905 (MUA15_08875) - 1885487..1885717 (-) 231 WP_002504786.1 hypothetical protein -
  MUA15_RS08910 (MUA15_08880) - 1885714..1886961 (-) 1248 WP_002504787.1 DnaB-like helicase C-terminal domain-containing protein -
  MUA15_RS08915 (MUA15_08885) - 1886951..1887304 (-) 354 WP_070653562.1 hypothetical protein -
  MUA15_RS08920 (MUA15_08890) - 1887310..1888038 (-) 729 WP_262619589.1 DnaD domain protein -
  MUA15_RS08925 (MUA15_08895) - 1888038..1888241 (-) 204 WP_049387177.1 helix-turn-helix domain-containing protein -
  MUA15_RS08930 (MUA15_08900) - 1888248..1888478 (-) 231 WP_262619590.1 helix-turn-helix domain-containing protein -
  MUA15_RS08935 (MUA15_08905) - 1888456..1889142 (-) 687 WP_262619592.1 putative HNHc nuclease -
  MUA15_RS08940 (MUA15_08910) ssbA 1889154..1889744 (-) 591 WP_262619593.1 single-stranded DNA-binding protein Machinery gene
  MUA15_RS08945 (MUA15_08915) - 1889747..1890370 (-) 624 WP_262619594.1 ERF family protein -
  MUA15_RS08950 (MUA15_08920) - 1890363..1890587 (-) 225 WP_262619595.1 DUF2483 domain-containing protein -
  MUA15_RS08955 (MUA15_08925) - 1890559..1890834 (-) 276 WP_103433361.1 chordopoxvirus fusion protein -
  MUA15_RS08960 (MUA15_08930) - 1890894..1891070 (-) 177 WP_002456867.1 hypothetical protein -
  MUA15_RS08965 (MUA15_08935) - 1891128..1891337 (-) 210 WP_046026347.1 hypothetical protein -
  MUA15_RS08970 (MUA15_08940) - 1891350..1892066 (-) 717 WP_002468739.1 phage repressor protein -
  MUA15_RS08975 (MUA15_08945) - 1892080..1892295 (-) 216 WP_001830251.1 transcriptional regulator -
  MUA15_RS08980 (MUA15_08950) - 1892492..1893103 (+) 612 WP_002468741.1 LexA family transcriptional regulator -
  MUA15_RS08985 (MUA15_08955) - 1893159..1894082 (+) 924 WP_002470864.1 DUF5067 domain-containing protein -
  MUA15_RS08990 (MUA15_08960) - 1894141..1895190 (+) 1050 WP_002468743.1 site-specific integrase -
  MUA15_RS09005 (MUA15_08975) comK/comK1 1895592..1896167 (-) 576 WP_001829272.1 competence protein ComK Regulator

Sequence

Protein


Download         Length: 191 a.a.        Molecular weight: 22782.87 Da        Isoelectric Point: 9.2887

>NTDB_id=671544 MUA15_RS09005 WP_001829272.1 1895592..1896167(-) (comK/comK1) [Staphylococcus epidermidis strain IVB6194]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN

Nucleotide


Download         Length: 576 bp        

>NTDB_id=671544 MUA15_RS09005 WP_001829272.1 1895592..1896167(-) (comK/comK1) [Staphylococcus epidermidis strain IVB6194]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
GACAAATGGTACTGAGATTATCAGATTTGATCAAACCCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAGTTTTATGGCAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATTTCTAGTAAACCACCT
ATTTTACTTACACCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCGGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCTTTAACACTCA
ATGTATCATTTCATAGTTTGTGGCATCAATACACCAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCCTCTTTAAATATTTTCGAGGCGCTTTCACGCTACTCTCT
TTTTGAAGAAAATTAG

Domains

Predicted by InterproScan.

ComK protein (ComK)

(7-158)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.757

96.859

0.743
  comK/comK1 Staphylococcus aureus N315

76.757

96.859

0.743