Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MUA51_RS03885 | Genome accession | NZ_CP094723 |
| Coordinates | 796919..797389 (+) | Length | 156 a.a. |
| NCBI ID | WP_262560550.1 | Uniprot ID | - |
| Organism | Staphylococcus sp. IVB6214 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 775188..827753 | 796919..797389 | within | 0 |
Gene organization within MGE regions
Location: 775188..827753
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA51_RS03725 (MUA51_03720) | - | 775188..776501 (-) | 1314 | WP_262559359.1 | ISL3 family transposase | - |
| MUA51_RS03730 (MUA51_03725) | - | 776793..777626 (-) | 834 | WP_262560523.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| MUA51_RS03735 (MUA51_03730) | - | 778102..779127 (-) | 1026 | WP_262560524.1 | site-specific integrase | - |
| MUA51_RS10800 | - | 779196..779849 (-) | 654 | WP_276580950.1 | CPBP family intramembrane glutamic endopeptidase | - |
| MUA51_RS03745 (MUA51_03740) | - | 780191..780979 (-) | 789 | WP_262560525.1 | DUF1828 domain-containing protein | - |
| MUA51_RS03750 (MUA51_03745) | - | 780993..781448 (-) | 456 | WP_262560526.1 | hypothetical protein | - |
| MUA51_RS03755 (MUA51_03750) | - | 782757..783551 (-) | 795 | WP_262560527.1 | Eco47II family restriction endonuclease | - |
| MUA51_RS03760 (MUA51_03755) | - | 783532..784557 (-) | 1026 | WP_262560528.1 | DNA cytosine methyltransferase | - |
| MUA51_RS03765 (MUA51_03760) | - | 784652..785173 (-) | 522 | WP_262560529.1 | DUF4352 domain-containing protein | - |
| MUA51_RS03770 (MUA51_03765) | - | 785430..785639 (-) | 210 | WP_262560530.1 | hypothetical protein | - |
| MUA51_RS03775 (MUA51_03770) | - | 785726..785962 (-) | 237 | Protein_731 | S24 family peptidase | - |
| MUA51_RS03780 (MUA51_03775) | - | 786004..786396 (-) | 393 | WP_262560531.1 | hypothetical protein | - |
| MUA51_RS03785 (MUA51_03780) | - | 786389..787342 (-) | 954 | WP_262560532.1 | exonuclease domain-containing protein | - |
| MUA51_RS03790 (MUA51_03785) | - | 787329..787802 (-) | 474 | WP_262560533.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MUA51_RS03795 (MUA51_03790) | - | 787812..788147 (-) | 336 | WP_262560534.1 | helix-turn-helix transcriptional regulator | - |
| MUA51_RS03800 (MUA51_03795) | - | 788322..788561 (+) | 240 | WP_262560535.1 | helix-turn-helix transcriptional regulator | - |
| MUA51_RS03805 (MUA51_03800) | - | 788576..789373 (+) | 798 | WP_262560536.1 | phage antirepressor KilAC domain-containing protein | - |
| MUA51_RS03810 (MUA51_03805) | - | 789385..789627 (+) | 243 | WP_262560537.1 | hypothetical protein | - |
| MUA51_RS03815 (MUA51_03810) | - | 789584..790087 (-) | 504 | WP_262560538.1 | hypothetical protein | - |
| MUA51_RS03820 (MUA51_03815) | - | 790144..790428 (+) | 285 | WP_262560539.1 | hypothetical protein | - |
| MUA51_RS03825 (MUA51_03820) | - | 790433..790972 (-) | 540 | WP_262560540.1 | hypothetical protein | - |
| MUA51_RS03830 (MUA51_03825) | - | 791060..791257 (+) | 198 | WP_262560541.1 | hypothetical protein | - |
| MUA51_RS03835 (MUA51_03830) | - | 791244..791624 (-) | 381 | WP_262560542.1 | DUF2513 domain-containing protein | - |
| MUA51_RS03840 (MUA51_03835) | - | 791675..791983 (+) | 309 | WP_262560543.1 | hypothetical protein | - |
| MUA51_RS03845 (MUA51_03840) | - | 792034..792282 (+) | 249 | WP_262560544.1 | DUF2829 domain-containing protein | - |
| MUA51_RS03850 (MUA51_03845) | - | 792298..792621 (+) | 324 | WP_262560545.1 | DUF771 domain-containing protein | - |
| MUA51_RS03855 (MUA51_03850) | - | 792623..792802 (+) | 180 | WP_262560546.1 | hypothetical protein | - |
| MUA51_RS03860 (MUA51_03855) | - | 792884..793162 (+) | 279 | WP_262560547.1 | DUF1108 family protein | - |
| MUA51_RS03865 (MUA51_03860) | - | 793158..795098 (+) | 1941 | WP_262560865.1 | AAA family ATPase | - |
| MUA51_RS03870 (MUA51_03865) | - | 795088..795291 (+) | 204 | WP_262560548.1 | helix-turn-helix transcriptional regulator | - |
| MUA51_RS03875 (MUA51_03870) | - | 795306..796217 (+) | 912 | WP_262560549.1 | RecT family recombinase | - |
| MUA51_RS03880 (MUA51_03875) | - | 796229..796918 (+) | 690 | WP_262560866.1 | MBL fold metallo-hydrolase | - |
| MUA51_RS03885 (MUA51_03880) | ssbA | 796919..797389 (+) | 471 | WP_262560550.1 | single-stranded DNA-binding protein | Machinery gene |
| MUA51_RS03890 (MUA51_03885) | - | 797410..797733 (+) | 324 | WP_262560551.1 | hypothetical protein | - |
| MUA51_RS03895 (MUA51_03890) | - | 797939..798718 (+) | 780 | WP_262560552.1 | conserved phage C-terminal domain-containing protein | - |
| MUA51_RS03900 (MUA51_03895) | - | 798737..799498 (+) | 762 | WP_262560867.1 | ATP-binding protein | - |
| MUA51_RS03905 (MUA51_03900) | - | 799492..799659 (+) | 168 | WP_262560868.1 | hypothetical protein | - |
| MUA51_RS03910 (MUA51_03905) | - | 799660..799869 (+) | 210 | WP_262560553.1 | hypothetical protein | - |
| MUA51_RS03915 (MUA51_03910) | - | 799880..800305 (+) | 426 | WP_262560554.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MUA51_RS03920 (MUA51_03915) | - | 800307..800987 (+) | 681 | WP_262560555.1 | hypothetical protein | - |
| MUA51_RS03925 (MUA51_03920) | - | 801001..801408 (+) | 408 | WP_262560556.1 | DUF3310 domain-containing protein | - |
| MUA51_RS03930 (MUA51_03925) | - | 801606..801821 (+) | 216 | WP_262560557.1 | hypothetical protein | - |
| MUA51_RS03935 (MUA51_03930) | - | 801791..801970 (+) | 180 | WP_262560558.1 | hypothetical protein | - |
| MUA51_RS03940 (MUA51_03935) | - | 801967..802215 (+) | 249 | WP_262560559.1 | hypothetical protein | - |
| MUA51_RS03945 (MUA51_03940) | - | 802215..802538 (+) | 324 | WP_262560560.1 | hypothetical protein | - |
| MUA51_RS03950 (MUA51_03945) | - | 802538..802723 (+) | 186 | WP_262560561.1 | hypothetical protein | - |
| MUA51_RS03955 (MUA51_03950) | - | 802739..803164 (+) | 426 | WP_262560562.1 | transcriptional regulator | - |
| MUA51_RS03960 (MUA51_03955) | - | 803367..803552 (+) | 186 | WP_037567940.1 | type II toxin-antitoxin system HicA family toxin | - |
| MUA51_RS03965 (MUA51_03960) | - | 803587..803982 (+) | 396 | WP_262560563.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| MUA51_RS03970 (MUA51_03965) | - | 804094..804414 (+) | 321 | WP_262560565.1 | HNH endonuclease signature motif containing protein | - |
| MUA51_RS03975 (MUA51_03970) | - | 804534..804839 (+) | 306 | WP_262560566.1 | P27 family phage terminase small subunit | - |
| MUA51_RS03980 (MUA51_03975) | - | 804829..806520 (+) | 1692 | WP_262560567.1 | terminase large subunit | - |
| MUA51_RS03985 (MUA51_03980) | - | 806524..807789 (+) | 1266 | WP_262560568.1 | phage portal protein | - |
| MUA51_RS03990 (MUA51_03985) | - | 807743..808516 (+) | 774 | WP_262560569.1 | head maturation protease, ClpP-related | - |
| MUA51_RS03995 (MUA51_03990) | - | 808529..809680 (+) | 1152 | WP_262560570.1 | phage major capsid protein | - |
| MUA51_RS04000 (MUA51_03995) | - | 809777..810055 (+) | 279 | WP_262560571.1 | head-tail connector protein | - |
| MUA51_RS04005 (MUA51_04000) | - | 810068..810400 (+) | 333 | WP_262560572.1 | hypothetical protein | - |
| MUA51_RS04010 (MUA51_04005) | - | 810391..810825 (+) | 435 | WP_262560573.1 | hypothetical protein | - |
| MUA51_RS04015 (MUA51_04010) | - | 810822..811229 (+) | 408 | WP_262560574.1 | hypothetical protein | - |
| MUA51_RS04020 (MUA51_04015) | - | 811241..811873 (+) | 633 | WP_262560575.1 | major tail protein | - |
| MUA51_RS04025 (MUA51_04020) | - | 811947..812111 (+) | 165 | WP_262560577.1 | hypothetical protein | - |
| MUA51_RS04030 (MUA51_04025) | - | 812125..812487 (+) | 363 | WP_262560578.1 | hypothetical protein | - |
| MUA51_RS04035 (MUA51_04030) | - | 812740..818079 (+) | 5340 | WP_262560579.1 | phage tail tape measure protein | - |
| MUA51_RS04040 (MUA51_04035) | - | 818079..819593 (+) | 1515 | WP_262560580.1 | distal tail protein Dit | - |
| MUA51_RS04045 (MUA51_04040) | - | 819609..824072 (+) | 4464 | WP_262560581.1 | phage tail spike protein | - |
| MUA51_RS04050 (MUA51_04045) | - | 824069..824242 (+) | 174 | WP_262560582.1 | hypothetical protein | - |
| MUA51_RS04055 (MUA51_04050) | - | 824288..824590 (+) | 303 | WP_262560583.1 | hypothetical protein | - |
| MUA51_RS04060 (MUA51_04055) | - | 824590..825081 (+) | 492 | WP_262560584.1 | phage holin family protein | - |
| MUA51_RS04065 (MUA51_04060) | - | 825117..826577 (+) | 1461 | WP_262560585.1 | SH3 domain-containing protein | - |
| MUA51_RS04070 (MUA51_04065) | - | 826841..827365 (+) | 525 | WP_262560586.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| MUA51_RS04075 (MUA51_04070) | - | 827355..827753 (+) | 399 | WP_262560869.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17587.41 Da Isoelectric Point: 5.1949
>NTDB_id=671290 MUA51_RS03885 WP_262560550.1 796919..797389(+) (ssbA) [Staphylococcus sp. IVB6214]
MINRVVLTGRLTKDPEMRMTQSGVQIANFTLAVNRTFTNAQGERQADFINCIAFKKTAENVNNYLQKGNLTGVDGRLQSR
SYENQEGRRVYVTEVVCDNVQFLEPKNSENTQTSNTYQYNQPPQTNSYQQKQQPIGGNPFGNANGPIDISDDDLPF
MINRVVLTGRLTKDPEMRMTQSGVQIANFTLAVNRTFTNAQGERQADFINCIAFKKTAENVNNYLQKGNLTGVDGRLQSR
SYENQEGRRVYVTEVVCDNVQFLEPKNSENTQTSNTYQYNQPPQTNSYQQKQQPIGGNPFGNANGPIDISDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=671290 MUA51_RS03885 WP_262560550.1 796919..797389(+) (ssbA) [Staphylococcus sp. IVB6214]
ATGATCAATAGAGTAGTTTTAACAGGGCGATTGACAAAAGACCCAGAAATGCGTATGACACAGTCTGGCGTACAAATAGC
TAATTTTACATTAGCAGTCAATCGTACATTCACAAATGCGCAAGGTGAACGTCAAGCAGACTTTATCAACTGCATAGCGT
TCAAAAAAACAGCAGAGAACGTCAACAACTATCTACAAAAAGGTAATTTGACTGGTGTTGATGGTCGCTTACAGTCACGC
AGTTACGAAAACCAAGAAGGCCGACGCGTCTATGTTACTGAAGTTGTTTGTGATAATGTTCAGTTTTTAGAGCCTAAAAA
CAGTGAGAACACGCAAACAAGTAACACATATCAATACAATCAGCCACCACAAACTAATAGCTATCAACAAAAACAGCAAC
CAATTGGTGGTAATCCATTTGGCAATGCGAATGGCCCGATAGATATTAGTGATGATGACTTACCGTTCTAA
ATGATCAATAGAGTAGTTTTAACAGGGCGATTGACAAAAGACCCAGAAATGCGTATGACACAGTCTGGCGTACAAATAGC
TAATTTTACATTAGCAGTCAATCGTACATTCACAAATGCGCAAGGTGAACGTCAAGCAGACTTTATCAACTGCATAGCGT
TCAAAAAAACAGCAGAGAACGTCAACAACTATCTACAAAAAGGTAATTTGACTGGTGTTGATGGTCGCTTACAGTCACGC
AGTTACGAAAACCAAGAAGGCCGACGCGTCTATGTTACTGAAGTTGTTTGTGATAATGTTCAGTTTTTAGAGCCTAAAAA
CAGTGAGAACACGCAAACAAGTAACACATATCAATACAATCAGCCACCACAAACTAATAGCTATCAACAAAAACAGCAAC
CAATTGGTGGTAATCCATTTGGCAATGCGAATGGCCCGATAGATATTAGTGATGATGACTTACCGTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.596 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.941 |
100 |
0.577 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.716 |
69.872 |
0.41 |