Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MQC90_RS17225 Genome accession   NZ_CP094361
Coordinates   3252311..3252451 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain NCIB 3610     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3247311..3257451
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MQC90_RS17200 yuxO 3247624..3248004 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  MQC90_RS17205 comA 3248023..3248667 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MQC90_RS17210 comP 3248748..3251057 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  MQC90_RS17215 comX 3251072..3251239 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  MQC90_RS17220 comQ 3251227..3252126 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  MQC90_RS17225 degQ 3252311..3252451 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MQC90_RS17230 - 3252673..3252798 (+) 126 WP_003228793.1 hypothetical protein -
  MQC90_RS17235 - 3252912..3253280 (+) 369 WP_003243784.1 hypothetical protein -
  MQC90_RS17240 pdeH 3253256..3254485 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  MQC90_RS17245 pncB 3254622..3256094 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MQC90_RS17250 pncA 3256110..3256661 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  MQC90_RS17255 yueI 3256758..3257156 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=669309 MQC90_RS17225 WP_003220708.1 3252311..3252451(-) (degQ) [Bacillus subtilis strain NCIB 3610]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=669309 MQC90_RS17225 WP_003220708.1 3252311..3252451(-) (degQ) [Bacillus subtilis strain NCIB 3610]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment