Detailed information
Overview
| Name | comEA | Type | Machinery gene |
| Locus tag | MQC90_RS13860 | Genome accession | NZ_CP094361 |
| Coordinates | 2635730..2636347 (-) | Length | 205 a.a. |
| NCBI ID | WP_004398514.1 | Uniprot ID | A0AAE2SLR2 |
| Organism | Bacillus subtilis strain NCIB 3610 | ||
| Function | dsDNA binding to the cell surface (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2632760..2694460 | 2635730..2636347 | within | 0 |
Gene organization within MGE regions
Location: 2632760..2694460
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MQC90_RS13850 | comEC | 2632760..2635090 (-) | 2331 | WP_009967776.1 | DNA internalization-related competence protein ComEC/Rec2 | Machinery gene |
| MQC90_RS13855 | comEB | 2635094..2635663 (-) | 570 | WP_003229978.1 | ComE operon protein 2 | - |
| MQC90_RS13860 | comEA | 2635730..2636347 (-) | 618 | WP_004398514.1 | competence protein ComEA | Machinery gene |
| MQC90_RS13865 | comER | 2636431..2637252 (+) | 822 | WP_004398597.1 | late competence protein ComER | - |
| MQC90_RS13870 | yqeM | 2637318..2638061 (-) | 744 | WP_003229973.1 | class I SAM-dependent methyltransferase | - |
| MQC90_RS13875 | rsfS | 2638058..2638414 (-) | 357 | WP_003229971.1 | ribosome silencing factor | - |
| MQC90_RS13880 | yqeK | 2638432..2638992 (-) | 561 | WP_004399059.1 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK | - |
| MQC90_RS13885 | nadD | 2638982..2639551 (-) | 570 | WP_004398676.1 | nicotinate-nucleotide adenylyltransferase | - |
| MQC90_RS13890 | yhbY | 2639563..2639853 (-) | 291 | WP_003226133.1 | ribosome assembly RNA-binding protein YhbY | - |
| MQC90_RS13895 | aroE | 2639847..2640689 (-) | 843 | WP_003229967.1 | shikimate dehydrogenase | - |
| MQC90_RS13900 | yqeH | 2640707..2641807 (-) | 1101 | WP_003229966.1 | ribosome biogenesis GTPase YqeH | - |
| MQC90_RS13905 | yqeG | 2641811..2642329 (-) | 519 | WP_003226126.1 | YqeG family HAD IIIA-type phosphatase | - |
| MQC90_RS13910 | - | 2642691..2642831 (+) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| MQC90_RS13915 | yqeF | 2643137..2643868 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| MQC90_RS13920 | cwlH | 2644120..2644872 (-) | 753 | WP_003229963.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| MQC90_RS13925 | yqeD | 2645059..2645685 (+) | 627 | WP_003229962.1 | TVP38/TMEM64 family protein | - |
| MQC90_RS13930 | gnd | 2645704..2646597 (-) | 894 | WP_003229961.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| MQC90_RS13935 | yqeB | 2646849..2647571 (+) | 723 | WP_010886572.1 | hypothetical protein | - |
| MQC90_RS13940 | nucA/comI | 2647604..2648014 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| MQC90_RS13945 | - | 2648210..2648557 (+) | 348 | Protein_2700 | sigma-70 family RNA polymerase sigma factor | - |
| MQC90_RS13950 | spoIVCA | 2648588..2650048 (-) | 1461 | WP_223257626.1 | site-specific DNA recombinase SpoIVCA | - |
| MQC90_RS13955 | - | 2650006..2650184 (-) | 179 | Protein_2702 | hypothetical protein | - |
| MQC90_RS13960 | arsC | 2650539..2650958 (-) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| MQC90_RS13965 | acr3 | 2650970..2652010 (-) | 1041 | WP_004398718.1 | arsenite efflux transporter Acr3 | - |
| MQC90_RS13970 | yqcK | 2652033..2652473 (-) | 441 | WP_003229954.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| MQC90_RS13975 | arsR | 2652534..2652851 (-) | 318 | WP_004399122.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| MQC90_RS13980 | yqcI | 2653223..2653987 (-) | 765 | WP_004398670.1 | YqcI/YcgG family protein | - |
| MQC90_RS13985 | rapE | 2654430..2655557 (+) | 1128 | WP_004398842.1 | response regulator aspartate phosphatase RapE | - |
| MQC90_RS13990 | phrE | 2655547..2655681 (+) | 135 | WP_004398770.1 | phosphatase RapE inhibitor PhrE | - |
| MQC90_RS13995 | - | 2655791..2655949 (+) | 159 | WP_003245945.1 | hypothetical protein | - |
| MQC90_RS14000 | yqcG | 2656319..2657914 (+) | 1596 | WP_004399034.1 | LXG family T7SS effector endonuclease toxin YqcG | - |
| MQC90_RS14005 | yqcF | 2657929..2658507 (+) | 579 | WP_009967790.1 | type VII secretion system immunity protein YqcF | - |
| MQC90_RS14010 | - | 2658625..2658771 (+) | 147 | WP_009967791.1 | hypothetical protein | - |
| MQC90_RS14015 | - | 2658768..2659130 (-) | 363 | WP_003229947.1 | hypothetical protein | - |
| MQC90_RS14020 | - | 2659146..2659625 (-) | 480 | WP_004399085.1 | hypothetical protein | - |
| MQC90_RS14025 | cwlA | 2659790..2660608 (-) | 819 | WP_003229946.1 | N-acetylmuramoyl-L-alanine amidase CwlA | - |
| MQC90_RS14030 | yqxH | 2660653..2661075 (-) | 423 | WP_003246208.1 | holin family protein | - |
| MQC90_RS14035 | yqxG | 2661120..2662013 (-) | 894 | WP_003246010.1 | hypothetical protein | - |
| MQC90_RS14040 | yqcE | 2662101..2662265 (-) | 165 | WP_003229944.1 | XkdX family protein | - |
| MQC90_RS14045 | yqcD | 2662262..2662597 (-) | 336 | WP_009967793.1 | XkdW family protein | - |
| MQC90_RS14050 | yqcC | 2662607..2663707 (-) | 1101 | WP_003229943.1 | pyocin knob domain-containing protein | - |
| MQC90_RS14055 | - | 2663710..2663982 (-) | 273 | WP_003229942.1 | hypothetical protein | - |
| MQC90_RS14060 | yqcA | 2663979..2664557 (-) | 579 | WP_003229941.1 | YmfQ family protein | - |
| MQC90_RS14065 | yqbT | 2664541..2665587 (-) | 1047 | WP_003229940.1 | baseplate J/gp47 family protein | - |
| MQC90_RS14070 | yqbS | 2665580..2666005 (-) | 426 | WP_004398572.1 | DUF2634 domain-containing protein | - |
| MQC90_RS14075 | yqbR | 2666018..2666281 (-) | 264 | WP_003229938.1 | DUF2577 family protein | - |
| MQC90_RS14080 | yqbQ | 2666278..2667258 (-) | 981 | WP_004398524.1 | hypothetical protein | - |
| MQC90_RS14085 | yqbP | 2667271..2667930 (-) | 660 | WP_004398548.1 | LysM peptidoglycan-binding domain-containing protein | - |
| MQC90_RS14090 | yqbO | 2667923..2672680 (-) | 4758 | WP_003246092.1 | phage tail tape measure protein | - |
| MQC90_RS14095 | - | 2672683..2672820 (-) | 138 | WP_003229934.1 | hypothetical protein | - |
| MQC90_RS14100 | - | 2672862..2673311 (-) | 450 | WP_003229933.1 | phage portal protein | - |
| MQC90_RS14105 | txpA | 2673457..2673636 (+) | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | - |
| MQC90_RS14110 | bsrH | 2674016..2674105 (+) | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| MQC90_RS14115 | yqbM | 2674359..2674802 (-) | 444 | WP_003229930.1 | phage tail tube protein | - |
| MQC90_RS14120 | yqbK | 2674805..2676205 (-) | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| MQC90_RS14125 | - | 2676206..2676397 (-) | 192 | WP_010886574.1 | hypothetical protein | - |
| MQC90_RS14130 | yqbJ | 2676394..2676831 (-) | 438 | WP_003229927.1 | DUF6838 family protein | - |
| MQC90_RS14135 | yqbI | 2676844..2677347 (-) | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| MQC90_RS14140 | yqbH | 2677344..2677706 (-) | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| MQC90_RS14145 | yqbG | 2677703..2678098 (-) | 396 | WP_004398566.1 | DUF3199 family protein | - |
| MQC90_RS14150 | yqbF | 2678102..2678413 (-) | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
| MQC90_RS14155 | yqbE | 2678424..2679359 (-) | 936 | WP_003229922.1 | phage major capsid protein | - |
| MQC90_RS14160 | yqbD | 2679378..2680346 (-) | 969 | WP_003229921.1 | XkdF-like putative serine protease domain-containing protein | - |
| MQC90_RS14165 | - | 2680379..2681032 (-) | 654 | WP_003229920.1 | hypothetical protein | - |
| MQC90_RS14170 | yqbB | 2681073..2681990 (-) | 918 | WP_004398748.1 | phage head morphogenesis protein | - |
| MQC90_RS14175 | yqbA | 2681987..2683519 (-) | 1533 | WP_004398894.1 | phage portal protein | - |
| MQC90_RS14180 | yqaT | 2683523..2684818 (-) | 1296 | WP_003229917.1 | PBSX family phage terminase large subunit | - |
| MQC90_RS14185 | terS | 2684811..2685530 (-) | 720 | WP_003229916.1 | phage terminase small subunit | - |
| MQC90_RS14190 | - | 2685598..2686062 (-) | 465 | WP_004398685.1 | hypothetical protein | - |
| MQC90_RS14195 | yqaQ | 2686206..2686661 (-) | 456 | WP_004398775.1 | hypothetical protein | - |
| MQC90_RS14200 | - | 2686859..2687788 (+) | 930 | WP_003229913.1 | hypothetical protein | - |
| MQC90_RS14205 | yqaO | 2687862..2688068 (-) | 207 | WP_003229912.1 | XtrA/YqaO family protein | - |
| MQC90_RS14210 | yqaN | 2688150..2688578 (-) | 429 | WP_009967809.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MQC90_RS14215 | - | 2688674..2688823 (-) | 150 | WP_003229910.1 | hypothetical protein | - |
| MQC90_RS14220 | sknM | 2688814..2689755 (-) | 942 | WP_075058863.1 | ATP-binding protein | - |
| MQC90_RS14225 | yqaL | 2689637..2690314 (-) | 678 | WP_010886575.1 | DnaD domain protein | - |
| MQC90_RS14230 | yqaK | 2690390..2691244 (-) | 855 | WP_003229907.1 | recombinase RecT | - |
| MQC90_RS14235 | yqaJ | 2691247..2692206 (-) | 960 | WP_004398673.1 | YqaJ viral recombinase family protein | - |
| MQC90_RS14240 | - | 2692312..2692506 (-) | 195 | WP_003229905.1 | hypothetical protein | - |
| MQC90_RS14245 | - | 2692466..2692639 (-) | 174 | WP_119123069.1 | hypothetical protein | - |
| MQC90_RS14250 | sknH | 2692636..2692893 (-) | 258 | WP_003245994.1 | YqaH family protein | - |
| MQC90_RS14255 | yqaG | 2692890..2693459 (-) | 570 | WP_004398626.1 | helix-turn-helix transcriptional regulator | - |
| MQC90_RS14260 | - | 2693533..2693673 (-) | 141 | WP_003229902.1 | hypothetical protein | - |
| MQC90_RS14265 | yqaF | 2693703..2693933 (-) | 231 | WP_004398958.1 | helix-turn-helix transcriptional regulator | - |
| MQC90_RS14270 | sknR | 2694110..2694460 (+) | 351 | WP_004398704.1 | transcriptional regulator SknR | - |
Sequence
Protein
Download Length: 205 a.a. Molecular weight: 21769.45 Da Isoelectric Point: 4.7220
>NTDB_id=669295 MQC90_RS13860 WP_004398514.1 2635730..2636347(-) (comEA) [Bacillus subtilis strain NCIB 3610]
MNWLNQHKKAIILAASAAVFTAIMIFLATGKNKEPVKQAVPTETENTVVKQEANNDESNETIVIDIKGAVQHPGVYEMRT
GDRVSQAIEKAGGTSEQADEAQVNLAEILQDGTVVYIPKKGEETAVQQGGGGSVQSDGGKGALVNINTATLEELQGISGV
GPSKAEAIIAYREENGRFQTIEDITKVSGIGEKSFEKIKSSITVK
MNWLNQHKKAIILAASAAVFTAIMIFLATGKNKEPVKQAVPTETENTVVKQEANNDESNETIVIDIKGAVQHPGVYEMRT
GDRVSQAIEKAGGTSEQADEAQVNLAEILQDGTVVYIPKKGEETAVQQGGGGSVQSDGGKGALVNINTATLEELQGISGV
GPSKAEAIIAYREENGRFQTIEDITKVSGIGEKSFEKIKSSITVK
Nucleotide
Download Length: 618 bp
>NTDB_id=669295 MQC90_RS13860 WP_004398514.1 2635730..2636347(-) (comEA) [Bacillus subtilis strain NCIB 3610]
ATGAATTGGTTGAATCAGCATAAGAAAGCAATTATTTTAGCGGCTTCTGCGGCTGTTTTCACAGCGATTATGATCTTTCT
GGCCACAGGGAAAAATAAAGAGCCGGTGAAGCAAGCTGTACCAACAGAGACAGAAAATACAGTGGTAAAGCAGGAAGCAA
ACAACGACGAGTCAAACGAAACAATTGTGATAGACATCAAAGGTGCTGTTCAGCATCCTGGCGTTTATGAAATGCGAACA
GGGGACAGAGTATCTCAGGCAATTGAGAAAGCGGGCGGGACCAGTGAACAAGCAGACGAAGCGCAAGTAAATTTGGCGGA
GATTCTGCAGGACGGGACAGTGGTGTACATCCCGAAAAAGGGAGAGGAAACAGCAGTGCAGCAAGGTGGCGGAGGGTCTG
TCCAAAGCGATGGAGGGAAGGGAGCGCTGGTGAATATCAATACAGCAACCTTAGAGGAGTTACAAGGCATCTCAGGGGTG
GGGCCATCCAAAGCTGAAGCTATTATTGCATACCGGGAGGAAAACGGTCGTTTCCAAACAATTGAAGATATCACTAAGGT
TTCAGGAATAGGTGAAAAGTCATTTGAGAAAATAAAGTCTTCCATTACAGTAAAGTGA
ATGAATTGGTTGAATCAGCATAAGAAAGCAATTATTTTAGCGGCTTCTGCGGCTGTTTTCACAGCGATTATGATCTTTCT
GGCCACAGGGAAAAATAAAGAGCCGGTGAAGCAAGCTGTACCAACAGAGACAGAAAATACAGTGGTAAAGCAGGAAGCAA
ACAACGACGAGTCAAACGAAACAATTGTGATAGACATCAAAGGTGCTGTTCAGCATCCTGGCGTTTATGAAATGCGAACA
GGGGACAGAGTATCTCAGGCAATTGAGAAAGCGGGCGGGACCAGTGAACAAGCAGACGAAGCGCAAGTAAATTTGGCGGA
GATTCTGCAGGACGGGACAGTGGTGTACATCCCGAAAAAGGGAGAGGAAACAGCAGTGCAGCAAGGTGGCGGAGGGTCTG
TCCAAAGCGATGGAGGGAAGGGAGCGCTGGTGAATATCAATACAGCAACCTTAGAGGAGTTACAAGGCATCTCAGGGGTG
GGGCCATCCAAAGCTGAAGCTATTATTGCATACCGGGAGGAAAACGGTCGTTTCCAAACAATTGAAGATATCACTAAGGT
TTCAGGAATAGGTGAAAAGTCATTTGAGAAAATAAAGTCTTCCATTACAGTAAAGTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comEA | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |
| comEA | Staphylococcus aureus MW2 |
37.273 |
100 |
0.4 |
| comEA | Staphylococcus aureus N315 |
36.364 |
100 |
0.39 |