Detailed information    

insolico Bioinformatically predicted

Overview


Name   comEA   Type   Machinery gene
Locus tag   MQC90_RS13860 Genome accession   NZ_CP094361
Coordinates   2635730..2636347 (-) Length   205 a.a.
NCBI ID   WP_004398514.1    Uniprot ID   A0AAE2SLR2
Organism   Bacillus subtilis strain NCIB 3610     
Function   dsDNA binding to the cell surface (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2632760..2694460 2635730..2636347 within 0


Gene organization within MGE regions


Location: 2632760..2694460
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MQC90_RS13850 comEC 2632760..2635090 (-) 2331 WP_009967776.1 DNA internalization-related competence protein ComEC/Rec2 Machinery gene
  MQC90_RS13855 comEB 2635094..2635663 (-) 570 WP_003229978.1 ComE operon protein 2 -
  MQC90_RS13860 comEA 2635730..2636347 (-) 618 WP_004398514.1 competence protein ComEA Machinery gene
  MQC90_RS13865 comER 2636431..2637252 (+) 822 WP_004398597.1 late competence protein ComER -
  MQC90_RS13870 yqeM 2637318..2638061 (-) 744 WP_003229973.1 class I SAM-dependent methyltransferase -
  MQC90_RS13875 rsfS 2638058..2638414 (-) 357 WP_003229971.1 ribosome silencing factor -
  MQC90_RS13880 yqeK 2638432..2638992 (-) 561 WP_004399059.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK -
  MQC90_RS13885 nadD 2638982..2639551 (-) 570 WP_004398676.1 nicotinate-nucleotide adenylyltransferase -
  MQC90_RS13890 yhbY 2639563..2639853 (-) 291 WP_003226133.1 ribosome assembly RNA-binding protein YhbY -
  MQC90_RS13895 aroE 2639847..2640689 (-) 843 WP_003229967.1 shikimate dehydrogenase -
  MQC90_RS13900 yqeH 2640707..2641807 (-) 1101 WP_003229966.1 ribosome biogenesis GTPase YqeH -
  MQC90_RS13905 yqeG 2641811..2642329 (-) 519 WP_003226126.1 YqeG family HAD IIIA-type phosphatase -
  MQC90_RS13910 - 2642691..2642831 (+) 141 WP_003226124.1 sporulation histidine kinase inhibitor Sda -
  MQC90_RS13915 yqeF 2643137..2643868 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  MQC90_RS13920 cwlH 2644120..2644872 (-) 753 WP_003229963.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  MQC90_RS13925 yqeD 2645059..2645685 (+) 627 WP_003229962.1 TVP38/TMEM64 family protein -
  MQC90_RS13930 gnd 2645704..2646597 (-) 894 WP_003229961.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  MQC90_RS13935 yqeB 2646849..2647571 (+) 723 WP_010886572.1 hypothetical protein -
  MQC90_RS13940 nucA/comI 2647604..2648014 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  MQC90_RS13945 - 2648210..2648557 (+) 348 Protein_2700 sigma-70 family RNA polymerase sigma factor -
  MQC90_RS13950 spoIVCA 2648588..2650048 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  MQC90_RS13955 - 2650006..2650184 (-) 179 Protein_2702 hypothetical protein -
  MQC90_RS13960 arsC 2650539..2650958 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  MQC90_RS13965 acr3 2650970..2652010 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  MQC90_RS13970 yqcK 2652033..2652473 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  MQC90_RS13975 arsR 2652534..2652851 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  MQC90_RS13980 yqcI 2653223..2653987 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  MQC90_RS13985 rapE 2654430..2655557 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  MQC90_RS13990 phrE 2655547..2655681 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  MQC90_RS13995 - 2655791..2655949 (+) 159 WP_003245945.1 hypothetical protein -
  MQC90_RS14000 yqcG 2656319..2657914 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  MQC90_RS14005 yqcF 2657929..2658507 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  MQC90_RS14010 - 2658625..2658771 (+) 147 WP_009967791.1 hypothetical protein -
  MQC90_RS14015 - 2658768..2659130 (-) 363 WP_003229947.1 hypothetical protein -
  MQC90_RS14020 - 2659146..2659625 (-) 480 WP_004399085.1 hypothetical protein -
  MQC90_RS14025 cwlA 2659790..2660608 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  MQC90_RS14030 yqxH 2660653..2661075 (-) 423 WP_003246208.1 holin family protein -
  MQC90_RS14035 yqxG 2661120..2662013 (-) 894 WP_003246010.1 hypothetical protein -
  MQC90_RS14040 yqcE 2662101..2662265 (-) 165 WP_003229944.1 XkdX family protein -
  MQC90_RS14045 yqcD 2662262..2662597 (-) 336 WP_009967793.1 XkdW family protein -
  MQC90_RS14050 yqcC 2662607..2663707 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  MQC90_RS14055 - 2663710..2663982 (-) 273 WP_003229942.1 hypothetical protein -
  MQC90_RS14060 yqcA 2663979..2664557 (-) 579 WP_003229941.1 YmfQ family protein -
  MQC90_RS14065 yqbT 2664541..2665587 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  MQC90_RS14070 yqbS 2665580..2666005 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  MQC90_RS14075 yqbR 2666018..2666281 (-) 264 WP_003229938.1 DUF2577 family protein -
  MQC90_RS14080 yqbQ 2666278..2667258 (-) 981 WP_004398524.1 hypothetical protein -
  MQC90_RS14085 yqbP 2667271..2667930 (-) 660 WP_004398548.1 LysM peptidoglycan-binding domain-containing protein -
  MQC90_RS14090 yqbO 2667923..2672680 (-) 4758 WP_003246092.1 phage tail tape measure protein -
  MQC90_RS14095 - 2672683..2672820 (-) 138 WP_003229934.1 hypothetical protein -
  MQC90_RS14100 - 2672862..2673311 (-) 450 WP_003229933.1 phage portal protein -
  MQC90_RS14105 txpA 2673457..2673636 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  MQC90_RS14110 bsrH 2674016..2674105 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  MQC90_RS14115 yqbM 2674359..2674802 (-) 444 WP_003229930.1 phage tail tube protein -
  MQC90_RS14120 yqbK 2674805..2676205 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  MQC90_RS14125 - 2676206..2676397 (-) 192 WP_010886574.1 hypothetical protein -
  MQC90_RS14130 yqbJ 2676394..2676831 (-) 438 WP_003229927.1 DUF6838 family protein -
  MQC90_RS14135 yqbI 2676844..2677347 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  MQC90_RS14140 yqbH 2677344..2677706 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  MQC90_RS14145 yqbG 2677703..2678098 (-) 396 WP_004398566.1 DUF3199 family protein -
  MQC90_RS14150 yqbF 2678102..2678413 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  MQC90_RS14155 yqbE 2678424..2679359 (-) 936 WP_003229922.1 phage major capsid protein -
  MQC90_RS14160 yqbD 2679378..2680346 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  MQC90_RS14165 - 2680379..2681032 (-) 654 WP_003229920.1 hypothetical protein -
  MQC90_RS14170 yqbB 2681073..2681990 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  MQC90_RS14175 yqbA 2681987..2683519 (-) 1533 WP_004398894.1 phage portal protein -
  MQC90_RS14180 yqaT 2683523..2684818 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  MQC90_RS14185 terS 2684811..2685530 (-) 720 WP_003229916.1 phage terminase small subunit -
  MQC90_RS14190 - 2685598..2686062 (-) 465 WP_004398685.1 hypothetical protein -
  MQC90_RS14195 yqaQ 2686206..2686661 (-) 456 WP_004398775.1 hypothetical protein -
  MQC90_RS14200 - 2686859..2687788 (+) 930 WP_003229913.1 hypothetical protein -
  MQC90_RS14205 yqaO 2687862..2688068 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  MQC90_RS14210 yqaN 2688150..2688578 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  MQC90_RS14215 - 2688674..2688823 (-) 150 WP_003229910.1 hypothetical protein -
  MQC90_RS14220 sknM 2688814..2689755 (-) 942 WP_075058863.1 ATP-binding protein -
  MQC90_RS14225 yqaL 2689637..2690314 (-) 678 WP_010886575.1 DnaD domain protein -
  MQC90_RS14230 yqaK 2690390..2691244 (-) 855 WP_003229907.1 recombinase RecT -
  MQC90_RS14235 yqaJ 2691247..2692206 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  MQC90_RS14240 - 2692312..2692506 (-) 195 WP_003229905.1 hypothetical protein -
  MQC90_RS14245 - 2692466..2692639 (-) 174 WP_119123069.1 hypothetical protein -
  MQC90_RS14250 sknH 2692636..2692893 (-) 258 WP_003245994.1 YqaH family protein -
  MQC90_RS14255 yqaG 2692890..2693459 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  MQC90_RS14260 - 2693533..2693673 (-) 141 WP_003229902.1 hypothetical protein -
  MQC90_RS14265 yqaF 2693703..2693933 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  MQC90_RS14270 sknR 2694110..2694460 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence


Protein


Download         Length: 205 a.a.        Molecular weight: 21769.45 Da        Isoelectric Point: 4.7220

>NTDB_id=669295 MQC90_RS13860 WP_004398514.1 2635730..2636347(-) (comEA) [Bacillus subtilis strain NCIB 3610]
MNWLNQHKKAIILAASAAVFTAIMIFLATGKNKEPVKQAVPTETENTVVKQEANNDESNETIVIDIKGAVQHPGVYEMRT
GDRVSQAIEKAGGTSEQADEAQVNLAEILQDGTVVYIPKKGEETAVQQGGGGSVQSDGGKGALVNINTATLEELQGISGV
GPSKAEAIIAYREENGRFQTIEDITKVSGIGEKSFEKIKSSITVK

Nucleotide


Download         Length: 618 bp        

>NTDB_id=669295 MQC90_RS13860 WP_004398514.1 2635730..2636347(-) (comEA) [Bacillus subtilis strain NCIB 3610]
ATGAATTGGTTGAATCAGCATAAGAAAGCAATTATTTTAGCGGCTTCTGCGGCTGTTTTCACAGCGATTATGATCTTTCT
GGCCACAGGGAAAAATAAAGAGCCGGTGAAGCAAGCTGTACCAACAGAGACAGAAAATACAGTGGTAAAGCAGGAAGCAA
ACAACGACGAGTCAAACGAAACAATTGTGATAGACATCAAAGGTGCTGTTCAGCATCCTGGCGTTTATGAAATGCGAACA
GGGGACAGAGTATCTCAGGCAATTGAGAAAGCGGGCGGGACCAGTGAACAAGCAGACGAAGCGCAAGTAAATTTGGCGGA
GATTCTGCAGGACGGGACAGTGGTGTACATCCCGAAAAAGGGAGAGGAAACAGCAGTGCAGCAAGGTGGCGGAGGGTCTG
TCCAAAGCGATGGAGGGAAGGGAGCGCTGGTGAATATCAATACAGCAACCTTAGAGGAGTTACAAGGCATCTCAGGGGTG
GGGCCATCCAAAGCTGAAGCTATTATTGCATACCGGGAGGAAAACGGTCGTTTCCAAACAATTGAAGATATCACTAAGGT
TTCAGGAATAGGTGAAAAGTCATTTGAGAAAATAAAGTCTTCCATTACAGTAAAGTGA

Domains


Predicted by InterproScan.

(142-203)

(63-118)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comEA Bacillus subtilis subsp. subtilis str. 168

100

100

1

  comEA Staphylococcus aureus MW2

37.273

100

0.4

  comEA Staphylococcus aureus N315

36.364

100

0.39


Multiple sequence alignment