Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   MRZ06_RS05230 Genome accession   NZ_CP094348
Coordinates   1015388..1015894 (+) Length   168 a.a.
NCBI ID   WP_243367126.1    Uniprot ID   -
Organism   Macrococcus armenti strain CCM 2609     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1003700..1048074 1015388..1015894 within 0


Gene organization within MGE regions


Location: 1003700..1048074
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MRZ06_RS05130 (MRZ06_05125) - 1003700..1004854 (-) 1155 WP_243367094.1 site-specific integrase -
  MRZ06_RS05135 (MRZ06_05130) - 1004859..1005320 (-) 462 WP_243367096.1 ImmA/IrrE family metallo-endopeptidase -
  MRZ06_RS05140 (MRZ06_05135) - 1005498..1005701 (+) 204 WP_243367098.1 hypothetical protein -
  MRZ06_RS05145 (MRZ06_05140) - 1005692..1006558 (-) 867 WP_243367100.1 hypothetical protein -
  MRZ06_RS05150 (MRZ06_05145) - 1006617..1007243 (-) 627 WP_243367102.1 hypothetical protein -
  MRZ06_RS05155 (MRZ06_05150) - 1007415..1007756 (-) 342 WP_243367104.1 helix-turn-helix transcriptional regulator -
  MRZ06_RS05160 (MRZ06_05155) - 1007910..1008161 (+) 252 WP_243367106.1 helix-turn-helix transcriptional regulator -
  MRZ06_RS05165 (MRZ06_05160) - 1008340..1008780 (+) 441 WP_243367108.1 hypothetical protein -
  MRZ06_RS05170 (MRZ06_05165) - 1008794..1009039 (+) 246 WP_243367110.1 hypothetical protein -
  MRZ06_RS05175 (MRZ06_05170) - 1009041..1009232 (+) 192 WP_243367112.1 hypothetical protein -
  MRZ06_RS05180 (MRZ06_05175) - 1009233..1009445 (+) 213 WP_243367114.1 hypothetical protein -
  MRZ06_RS05185 (MRZ06_05180) - 1009442..1009663 (-) 222 WP_188020099.1 DUF2188 domain-containing protein -
  MRZ06_RS05190 (MRZ06_05185) - 1009820..1010581 (+) 762 WP_243367116.1 phage regulatory protein/antirepressor Ant -
  MRZ06_RS05195 (MRZ06_05190) - 1010971..1011912 (+) 942 WP_243367118.1 lambda-exonuclease family protein -
  MRZ06_RS05200 (MRZ06_05195) recT 1011918..1012748 (+) 831 WP_133418720.1 recombination protein RecT -
  MRZ06_RS05205 (MRZ06_05200) - 1012780..1013664 (+) 885 WP_243367120.1 phage replisome organizer N-terminal domain-containing protein -
  MRZ06_RS05210 (MRZ06_05205) - 1013642..1014427 (+) 786 WP_243367122.1 ATP-binding protein -
  MRZ06_RS05215 (MRZ06_05210) - 1014454..1015074 (+) 621 WP_243367124.1 hypothetical protein -
  MRZ06_RS05220 (MRZ06_05215) - 1015067..1015243 (+) 177 WP_224186187.1 hypothetical protein -
  MRZ06_RS05225 (MRZ06_05220) - 1015215..1015391 (+) 177 WP_224186188.1 hypothetical protein -
  MRZ06_RS05230 (MRZ06_05225) ssbA 1015388..1015894 (+) 507 WP_243367126.1 single-stranded DNA-binding protein Machinery gene
  MRZ06_RS05235 (MRZ06_05230) - 1015921..1016199 (+) 279 WP_243367128.1 hypothetical protein -
  MRZ06_RS05240 (MRZ06_05235) - 1016196..1016417 (+) 222 WP_243367130.1 hypothetical protein -
  MRZ06_RS05245 (MRZ06_05240) - 1016414..1016593 (+) 180 WP_243367132.1 hypothetical protein -
  MRZ06_RS05250 (MRZ06_05245) - 1016606..1016998 (+) 393 WP_243367134.1 hypothetical protein -
  MRZ06_RS05255 (MRZ06_05250) - 1017001..1017228 (+) 228 WP_243367136.1 helix-turn-helix transcriptional regulator -
  MRZ06_RS05260 (MRZ06_05255) - 1017231..1018472 (+) 1242 WP_243367138.1 DUF3310 domain-containing protein -
  MRZ06_RS05265 (MRZ06_05260) - 1018469..1018705 (+) 237 WP_243367140.1 hypothetical protein -
  MRZ06_RS05270 (MRZ06_05265) - 1018718..1018942 (+) 225 WP_243367141.1 hypothetical protein -
  MRZ06_RS05275 (MRZ06_05270) - 1018955..1019323 (+) 369 WP_243367143.1 YopX family protein -
  MRZ06_RS11260 - 1019684..1019815 (+) 132 WP_279306420.1 hypothetical protein -
  MRZ06_RS05280 (MRZ06_05275) - 1019854..1020273 (+) 420 WP_243367145.1 helix-turn-helix transcriptional regulator -
  MRZ06_RS05285 (MRZ06_05280) - 1020263..1020433 (+) 171 WP_243367146.1 hypothetical protein -
  MRZ06_RS05290 (MRZ06_05285) - 1020426..1020950 (+) 525 WP_243367148.1 dUTP diphosphatase -
  MRZ06_RS05295 (MRZ06_05290) - 1020993..1021478 (+) 486 WP_243367150.1 Holliday junction resolvase RecU -
  MRZ06_RS05300 (MRZ06_05295) - 1021495..1021899 (+) 405 WP_243367152.1 hypothetical protein -
  MRZ06_RS05305 (MRZ06_05300) - 1021960..1022487 (+) 528 WP_243367154.1 hypothetical protein -
  MRZ06_RS05310 (MRZ06_05305) - 1022750..1022929 (+) 180 WP_243367156.1 hypothetical protein -
  MRZ06_RS05315 (MRZ06_05310) - 1023096..1023800 (+) 705 WP_243367158.1 hypothetical protein -
  MRZ06_RS05320 (MRZ06_05315) - 1023797..1025089 (+) 1293 WP_243367160.1 PBSX family phage terminase large subunit -
  MRZ06_RS05325 (MRZ06_05320) - 1025101..1026720 (+) 1620 WP_243367162.1 hypothetical protein -
  MRZ06_RS05330 (MRZ06_05325) - 1026725..1027003 (+) 279 WP_243367164.1 hypothetical protein -
  MRZ06_RS05335 (MRZ06_05330) - 1027014..1028069 (+) 1056 WP_243367166.1 phage minor capsid protein -
  MRZ06_RS05340 (MRZ06_05335) - 1028619..1029227 (+) 609 WP_243367168.1 phage scaffolding protein -
  MRZ06_RS05345 (MRZ06_05340) - 1029240..1029605 (+) 366 WP_243367170.1 hypothetical protein -
  MRZ06_RS05350 (MRZ06_05345) - 1029629..1030636 (+) 1008 WP_243367172.1 major capsid protein -
  MRZ06_RS05355 (MRZ06_05350) - 1030677..1030952 (+) 276 WP_133418754.1 hypothetical protein -
  MRZ06_RS05360 (MRZ06_05355) - 1030970..1031353 (+) 384 WP_243367174.1 hypothetical protein -
  MRZ06_RS05365 (MRZ06_05360) - 1031365..1031697 (+) 333 WP_165981857.1 hypothetical protein -
  MRZ06_RS05370 (MRZ06_05365) - 1031687..1032169 (+) 483 WP_224186220.1 HK97 gp10 family phage protein -
  MRZ06_RS05375 (MRZ06_05370) - 1032174..1032566 (+) 393 WP_243367176.1 minor capsid protein -
  MRZ06_RS05380 (MRZ06_05375) - 1032620..1033210 (+) 591 WP_243367178.1 hypothetical protein -
  MRZ06_RS05385 (MRZ06_05380) - 1033288..1033809 (+) 522 WP_243367180.1 hypothetical protein -
  MRZ06_RS05390 (MRZ06_05385) - 1033764..1034147 (+) 384 WP_243367182.1 hypothetical protein -
  MRZ06_RS05395 (MRZ06_05390) - 1034187..1039844 (+) 5658 WP_243367187.1 LysM peptidoglycan-binding domain-containing protein -
  MRZ06_RS05400 (MRZ06_05395) - 1039837..1040271 (+) 435 WP_243367189.1 hypothetical protein -
  MRZ06_RS05405 (MRZ06_05400) - 1040271..1042064 (+) 1794 WP_243367191.1 phage tail spike protein -
  MRZ06_RS05410 (MRZ06_05405) - 1042075..1042341 (+) 267 WP_243367193.1 hypothetical protein -
  MRZ06_RS05415 (MRZ06_05410) - 1042343..1044613 (+) 2271 WP_243367195.1 polysaccharide deacetylase family protein -
  MRZ06_RS05420 (MRZ06_05415) - 1044706..1045293 (+) 588 WP_243367197.1 hypothetical protein -
  MRZ06_RS05425 (MRZ06_05420) - 1045366..1045587 (-) 222 WP_243367199.1 hypothetical protein -
  MRZ06_RS05430 (MRZ06_05425) - 1045589..1045831 (+) 243 WP_243367201.1 hypothetical protein -
  MRZ06_RS05435 (MRZ06_05430) - 1045818..1046204 (+) 387 WP_243367203.1 hypothetical protein -
  MRZ06_RS05440 (MRZ06_05435) - 1046250..1046516 (+) 267 WP_243367205.1 phage holin -
  MRZ06_RS05445 (MRZ06_05440) - 1046519..1047466 (+) 948 WP_243367206.1 SH3 domain-containing protein -
  MRZ06_RS05450 (MRZ06_05445) - 1047889..1048074 (+) 186 WP_243367208.1 helix-turn-helix transcriptional regulator -

Sequence


Protein


Download         Length: 168 a.a.        Molecular weight: 18799.56 Da        Isoelectric Point: 5.1576

>NTDB_id=669165 MRZ06_RS05230 WP_243367126.1 1015388..1015894(+) (ssbA) [Macrococcus armenti strain CCM 2609]
MINRVVLTGRLTKDPEFRVTPSGVSVATFTLAVNRMFTNDQGERQADFINCVTFRKQAENVNNFLSKGSLVGVDGRLQSR
SYDNQQGQRVFVTEVICDSVQFLEPKNSQNQQNNGAQQTNYNQANNNYQNNQNVIRGQNNANNGYAQKQDPFANATGPID
ISDDDLPF

Nucleotide


Download         Length: 507 bp        

>NTDB_id=669165 MRZ06_RS05230 WP_243367126.1 1015388..1015894(+) (ssbA) [Macrococcus armenti strain CCM 2609]
ATGATTAACAGAGTAGTGCTTACAGGAAGATTAACAAAGGATCCTGAATTCAGAGTAACGCCATCAGGAGTATCAGTTGC
TACATTCACTTTAGCAGTAAACCGCATGTTTACGAATGACCAGGGAGAACGACAAGCAGACTTCATAAATTGTGTAACTT
TTAGAAAACAAGCCGAAAACGTCAACAATTTCTTGAGTAAAGGTAGTCTAGTCGGTGTAGATGGAAGATTACAATCACGC
AGCTATGATAATCAACAAGGACAGCGTGTATTCGTTACAGAAGTGATTTGTGATAGCGTGCAGTTTCTTGAACCAAAGAA
TAGCCAAAATCAACAAAATAACGGCGCACAGCAAACGAATTACAACCAAGCGAACAACAACTATCAAAATAATCAAAACG
TCATCAGAGGTCAAAATAATGCAAATAACGGATATGCGCAGAAGCAAGATCCATTTGCTAATGCAACTGGACCTATTGAT
ATCAGTGATGATGATTTACCGTTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

64.205

100

0.673

  ssb Latilactobacillus sakei subsp. sakei 23K

57.059

100

0.577

  ssb Glaesserella parasuis strain SC1401

36.757

100

0.405


Multiple sequence alignment