Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG60_RS00720 Genome accession   NZ_CP094177
Coordinates   151804..151917 (+) Length   37 a.a.
NCBI ID   WP_073422943.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe062     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 146804..156917
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG60_RS00695 (MPG60_00695) - 146864..149086 (+) 2223 WP_245084820.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG60_RS00700 (MPG60_00700) panD 149076..149426 (+) 351 WP_015428297.1 aspartate 1-decarboxylase -
  MPG60_RS00705 (MPG60_00705) - 149437..149730 (+) 294 WP_154411272.1 YbaB/EbfC family nucleoid-associated protein -
  MPG60_RS00710 (MPG60_00710) - 149730..150725 (+) 996 WP_245085691.1 PDZ domain-containing protein -
  MPG60_RS00715 (MPG60_00715) comB6 150733..151788 (+) 1056 WP_057112300.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG60_RS00720 (MPG60_00720) comB7 151804..151917 (+) 114 WP_073422943.1 comB7 lipoprotein Machinery gene
  MPG60_RS00725 (MPG60_00725) comB8 151914..152657 (+) 744 WP_180483742.1 virB8 family protein Machinery gene
  MPG60_RS00730 (MPG60_00730) comB9 152657..153622 (+) 966 WP_245084823.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG60_RS00735 (MPG60_00735) comB10 153615..154751 (+) 1137 WP_245084826.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG60_RS00740 (MPG60_00740) - 154821..156233 (+) 1413 WP_245084829.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4287.23 Da        Isoelectric Point: 9.3572

>NTDB_id=668030 MPG60_RS00720 WP_073422943.1 151804..151917(+) (comB7) [Helicobacter pylori strain Hpfe062]
MRIFFVIIGLILFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=668030 MPG60_RS00720 WP_073422943.1 151804..151917(+) (comB7) [Helicobacter pylori strain Hpfe062]
ATGAGAATTTTTTTTGTTATTATTGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAATAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919


Multiple sequence alignment