Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG77_RS02230 Genome accession   NZ_CP094159
Coordinates   482393..482518 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe0020     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 477393..487518
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG77_RS02205 (MPG77_02205) - 477454..479670 (+) 2217 WP_245109901.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG77_RS02210 (MPG77_02210) panD 479667..480017 (+) 351 WP_000142212.1 aspartate 1-decarboxylase -
  MPG77_RS02215 (MPG77_02215) - 480028..480321 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG77_RS02220 (MPG77_02220) - 480321..481316 (+) 996 WP_245110191.1 PDZ domain-containing protein -
  MPG77_RS02225 (MPG77_02225) comB6 481322..482377 (+) 1056 WP_245110192.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG77_RS02230 (MPG77_02230) comB7 482393..482518 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG77_RS02235 (MPG77_02235) comB8 482515..483258 (+) 744 WP_245109903.1 virB8 family protein Machinery gene
  MPG77_RS02240 (MPG77_02240) comB9 483258..484220 (+) 963 WP_245109904.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG77_RS02245 (MPG77_02245) comB10 484213..485349 (+) 1137 WP_245109906.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG77_RS02250 (MPG77_02250) - 485419..486831 (+) 1413 WP_245109907.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=667770 MPG77_RS02230 WP_001217874.1 482393..482518(+) (comB7) [Helicobacter pylori strain Hpfe0020]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667770 MPG77_RS02230 WP_001217874.1 482393..482518(+) (comB7) [Helicobacter pylori strain Hpfe0020]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment