Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG67_RS00715 Genome accession   NZ_CP094156
Coordinates   150308..150433 (+) Length   41 a.a.
NCBI ID   WP_075668089.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe005     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 145308..155433
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG67_RS00690 (MPG67_00690) - 145368..147590 (+) 2223 WP_245072920.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG67_RS00695 (MPG67_00695) panD 147580..147930 (+) 351 WP_245050843.1 aspartate 1-decarboxylase -
  MPG67_RS00700 (MPG67_00700) - 147941..148234 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG67_RS00705 (MPG67_00705) - 148234..149229 (+) 996 WP_245073320.1 PDZ domain-containing protein -
  MPG67_RS00710 (MPG67_00710) comB6 149237..150292 (+) 1056 WP_245073322.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG67_RS00715 (MPG67_00715) comB7 150308..150433 (+) 126 WP_075668089.1 comB7 lipoprotein Machinery gene
  MPG67_RS00720 (MPG67_00720) comB8 150430..151173 (+) 744 WP_245072921.1 virB8 family protein Machinery gene
  MPG67_RS00725 (MPG67_00725) comB9 151173..152138 (+) 966 WP_245072922.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG67_RS00730 (MPG67_00730) comB10 152131..153267 (+) 1137 WP_245050853.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG67_RS00735 (MPG67_00735) - 153333..154745 (+) 1413 WP_245050855.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4738.72 Da        Isoelectric Point: 9.3278

>NTDB_id=667727 MPG67_RS00715 WP_075668089.1 150308..150433(+) (comB7) [Helicobacter pylori strain Hpfe005]
MRIFSVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667727 MPG67_RS00715 WP_075668089.1 150308..150433(+) (comB7) [Helicobacter pylori strain Hpfe005]
ATGAGAATTTTTTCTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854


Multiple sequence alignment