Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG83_RS00690 Genome accession   NZ_CP094140
Coordinates   148504..148629 (+) Length   41 a.a.
NCBI ID   WP_024117273.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe035     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 143504..153629
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG83_RS00665 (MPG83_00665) - 143569..145788 (+) 2220 WP_245071393.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG83_RS00670 (MPG83_00670) panD 145778..146128 (+) 351 WP_021306341.1 aspartate 1-decarboxylase -
  MPG83_RS00675 (MPG83_00675) - 146139..146432 (+) 294 WP_245071395.1 YbaB/EbfC family nucleoid-associated protein -
  MPG83_RS00680 (MPG83_00680) - 146432..147427 (+) 996 WP_245072124.1 PDZ domain-containing protein -
  MPG83_RS00685 (MPG83_00685) comB6 147433..148488 (+) 1056 WP_126131604.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG83_RS00690 (MPG83_00690) comB7 148504..148629 (+) 126 WP_024117273.1 hypothetical protein Machinery gene
  MPG83_RS00695 (MPG83_00695) comB8 148626..149369 (+) 744 WP_245038526.1 virB8 family protein Machinery gene
  MPG83_RS00700 (MPG83_00700) comB9 149369..150331 (+) 963 WP_245071397.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG83_RS00705 (MPG83_00705) comB10 150324..151460 (+) 1137 WP_245071399.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG83_RS00710 (MPG83_00710) - 151527..152939 (+) 1413 WP_245071401.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4752.75 Da        Isoelectric Point: 9.3278

>NTDB_id=667487 MPG83_RS00690 WP_024117273.1 148504..148629(+) (comB7) [Helicobacter pylori strain Hpfe035]
MRIFSVIMGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667487 MPG83_RS00690 WP_024117273.1 148504..148629(+) (comB7) [Helicobacter pylori strain Hpfe035]
ATGAGAATTTTTTCTGTCATTATGGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829

Multiple sequence alignment