Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPF95_RS00730 Genome accession   NZ_CP094136
Coordinates   155736..155849 (+) Length   37 a.a.
NCBI ID   WP_073422943.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe039     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 150736..160849
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPF95_RS00705 (MPF95_00705) - 150796..153018 (+) 2223 WP_245067110.1 ATP-dependent Clp protease ATP-binding subunit -
  MPF95_RS00710 (MPF95_00710) panD 153008..153358 (+) 351 WP_245067112.1 aspartate 1-decarboxylase -
  MPF95_RS00715 (MPF95_00715) - 153369..153662 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPF95_RS00720 (MPF95_00720) - 153662..154657 (+) 996 WP_245067794.1 PDZ domain-containing protein -
  MPF95_RS00725 (MPF95_00725) comB6 154665..155720 (+) 1056 WP_245067796.1 P-type conjugative transfer protein TrbL Machinery gene
  MPF95_RS00730 (MPF95_00730) comB7 155736..155849 (+) 114 WP_073422943.1 comB7 lipoprotein Machinery gene
  MPF95_RS00735 (MPF95_00735) comB8 155846..156589 (+) 744 WP_245067114.1 virB8 family protein Machinery gene
  MPF95_RS00740 (MPF95_00740) comB9 156589..157551 (+) 963 WP_245067116.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPF95_RS00745 (MPF95_00745) comB10 157544..158680 (+) 1137 WP_245067118.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPF95_RS00750 (MPF95_00750) - 158750..160162 (+) 1413 WP_245067120.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4287.23 Da        Isoelectric Point: 9.3572

>NTDB_id=667403 MPF95_RS00730 WP_073422943.1 155736..155849(+) (comB7) [Helicobacter pylori strain Hpfe039]
MRIFFVIIGLILFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=667403 MPF95_RS00730 WP_073422943.1 155736..155849(+) (comB7) [Helicobacter pylori strain Hpfe039]
ATGAGAATTTTTTTTGTTATTATTGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919


Multiple sequence alignment