Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG01_RS00710 Genome accession   NZ_CP094124
Coordinates   154867..154992 (+) Length   41 a.a.
NCBI ID   WP_001217867.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe057     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 149867..159992
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG01_RS00685 (MPG01_00685) - 149929..152151 (+) 2223 WP_245037785.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG01_RS00690 (MPG01_00690) panD 152141..152491 (+) 351 WP_000142213.1 aspartate 1-decarboxylase -
  MPG01_RS00695 (MPG01_00695) - 152502..152795 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG01_RS00700 (MPG01_00700) - 152795..153790 (+) 996 WP_245038366.1 PDZ domain-containing protein -
  MPG01_RS00705 (MPG01_00705) comB6 153796..154851 (+) 1056 WP_000786667.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG01_RS00710 (MPG01_00710) comB7 154867..154992 (+) 126 WP_001217867.1 hypothetical protein Machinery gene
  MPG01_RS00715 (MPG01_00715) comB8 154989..155726 (+) 738 WP_000660546.1 virB8 family protein Machinery gene
  MPG01_RS00720 (MPG01_00720) comB9 155726..156688 (+) 963 WP_245037787.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG01_RS00725 (MPG01_00725) comB10 156681..157835 (+) 1155 WP_245037789.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG01_RS00730 (MPG01_00730) - 157886..159298 (+) 1413 WP_245037791.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4830.88 Da        Isoelectric Point: 9.3278

>NTDB_id=667189 MPG01_RS00710 WP_001217867.1 154867..154992(+) (comB7) [Helicobacter pylori strain Hpfe057]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667189 MPG01_RS00710 WP_001217867.1 154867..154992(+) (comB7) [Helicobacter pylori strain Hpfe057]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTATTTGGTTGCACCAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829

Multiple sequence alignment