Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG74_RS00925 Genome accession   NZ_CP094120
Coordinates   194542..194655 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori strain Hpfe061     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 189542..199655
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG74_RS00900 (MPG74_00900) - 189602..191824 (+) 2223 WP_245069715.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG74_RS00905 (MPG74_00905) panD 191814..192164 (+) 351 WP_245069717.1 aspartate 1-decarboxylase -
  MPG74_RS00910 (MPG74_00910) - 192175..192468 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG74_RS00915 (MPG74_00915) - 192468..193463 (+) 996 WP_245070253.1 PDZ domain-containing protein -
  MPG74_RS00920 (MPG74_00920) comB6 193471..194526 (+) 1056 WP_245070255.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG74_RS00925 (MPG74_00925) comB7 194542..194655 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  MPG74_RS00930 (MPG74_00930) comB8 194652..195395 (+) 744 WP_245069719.1 virB8 family protein Machinery gene
  MPG74_RS00935 (MPG74_00935) comB9 195395..196357 (+) 963 WP_180577520.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG74_RS00940 (MPG74_00940) comB10 196350..197486 (+) 1137 WP_245069722.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG74_RS00945 (MPG74_00945) - 197552..198967 (+) 1416 WP_245069724.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=667127 MPG74_RS00925 WP_001217877.1 194542..194655(+) (comB7) [Helicobacter pylori strain Hpfe061]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=667127 MPG74_RS00925 WP_001217877.1 194542..194655(+) (comB7) [Helicobacter pylori strain Hpfe061]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1A9H2U2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973


Multiple sequence alignment