Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG22_RS00715 Genome accession   NZ_CP094111
Coordinates   149550..149675 (+) Length   41 a.a.
NCBI ID   WP_001217867.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe070     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 144550..154675
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG22_RS00690 (MPG22_00690) - 144612..146834 (+) 2223 WP_245065410.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG22_RS00695 (MPG22_00695) panD 146824..147174 (+) 351 WP_000142208.1 aspartate 1-decarboxylase -
  MPG22_RS00700 (MPG22_00700) - 147185..147478 (+) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  MPG22_RS00705 (MPG22_00705) - 147478..148473 (+) 996 WP_245065928.1 PDZ domain-containing protein -
  MPG22_RS00710 (MPG22_00710) comB6 148479..149534 (+) 1056 WP_245065930.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG22_RS00715 (MPG22_00715) comB7 149550..149675 (+) 126 WP_001217867.1 hypothetical protein Machinery gene
  MPG22_RS00720 (MPG22_00720) comB8 149672..150409 (+) 738 WP_245065411.1 virB8 family protein Machinery gene
  MPG22_RS00725 (MPG22_00725) comB9 150409..151371 (+) 963 WP_245065412.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG22_RS00730 (MPG22_00730) comB10 151364..152500 (+) 1137 WP_245065413.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG22_RS00735 (MPG22_00735) - 152570..153982 (+) 1413 WP_245065414.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4830.88 Da        Isoelectric Point: 9.3278

>NTDB_id=666999 MPG22_RS00715 WP_001217867.1 149550..149675(+) (comB7) [Helicobacter pylori strain Hpfe070]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666999 MPG22_RS00715 WP_001217867.1 149550..149675(+) (comB7) [Helicobacter pylori strain Hpfe070]
ATGAGAATTTTTTTTGTTATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829