Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG14_RS06295 Genome accession   NZ_CP094102
Coordinates   1310950..1311075 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe078     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1305950..1316075
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG14_RS06275 (MPG14_06275) - 1306636..1308048 (-) 1413 WP_245053736.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  MPG14_RS06280 (MPG14_06280) - 1308118..1309255 (-) 1138 Protein_1231 DNA type IV secretion system protein ComB10 -
  MPG14_RS06285 (MPG14_06285) comB9 1309248..1310210 (-) 963 WP_245053738.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG14_RS06290 (MPG14_06290) comB8 1310210..1310953 (-) 744 WP_000660524.1 virB8 family protein Machinery gene
  MPG14_RS06295 (MPG14_06295) comB7 1310950..1311075 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG14_RS06300 (MPG14_06300) comB6 1311091..1312146 (-) 1056 WP_245053740.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG14_RS06305 (MPG14_06305) - 1312152..1313147 (-) 996 WP_245054829.1 PDZ domain-containing protein -
  MPG14_RS06310 (MPG14_06310) - 1313147..1313440 (-) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  MPG14_RS06315 (MPG14_06315) panD 1313451..1313801 (-) 351 WP_245053742.1 aspartate 1-decarboxylase -
  MPG14_RS06320 (MPG14_06320) - 1313791..1316013 (-) 2223 WP_245053744.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=666880 MPG14_RS06295 WP_001217874.1 1310950..1311075(-) (comB7) [Helicobacter pylori strain Hpfe078]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666880 MPG14_RS06295 WP_001217874.1 1310950..1311075(-) (comB7) [Helicobacter pylori strain Hpfe078]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878