Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG47_RS00680 Genome accession   NZ_CP094095
Coordinates   150415..150540 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe083     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 145415..155540
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG47_RS00655 (MPG47_00655) - 145475..147697 (+) 2223 WP_245016230.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG47_RS00660 (MPG47_00660) panD 147687..148037 (+) 351 WP_245016231.1 aspartate 1-decarboxylase -
  MPG47_RS00665 (MPG47_00665) - 148048..148341 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG47_RS00670 (MPG47_00670) - 148341..149336 (+) 996 WP_245016555.1 PDZ domain-containing protein -
  MPG47_RS00675 (MPG47_00675) comB6 149344..150399 (+) 1056 WP_245016556.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG47_RS00680 (MPG47_00680) comB7 150415..150540 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG47_RS00685 (MPG47_00685) comB8 150537..151274 (+) 738 WP_180426496.1 virB8 family protein Machinery gene
  MPG47_RS00690 (MPG47_00690) comB9 151274..152239 (+) 966 WP_245016232.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG47_RS00695 (MPG47_00695) comB10 152232..153368 (+) 1137 WP_245016233.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG47_RS00700 (MPG47_00700) - 153438..154850 (+) 1413 WP_245016234.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=666769 MPG47_RS00680 WP_001217874.1 150415..150540(+) (comB7) [Helicobacter pylori strain Hpfe083]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666769 MPG47_RS00680 WP_001217874.1 150415..150540(+) (comB7) [Helicobacter pylori strain Hpfe083]
ATGAGAATTTTTTTTGTTATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878