Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPF86_RS00730 Genome accession   NZ_CP094091
Coordinates   152460..152585 (+) Length   41 a.a.
NCBI ID   WP_075668089.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe088     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 147460..157585
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPF86_RS00705 (MPF86_00705) - 147520..149742 (+) 2223 WP_245064534.1 ATP-dependent Clp protease ATP-binding subunit -
  MPF86_RS00710 (MPF86_00710) panD 149732..150082 (+) 351 WP_245064535.1 aspartate 1-decarboxylase -
  MPF86_RS00715 (MPF86_00715) - 150093..150386 (+) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  MPF86_RS00720 (MPF86_00720) - 150386..151381 (+) 996 WP_245064536.1 PDZ domain-containing protein -
  MPF86_RS00725 (MPF86_00725) comB6 151389..152444 (+) 1056 WP_245064537.1 P-type conjugative transfer protein TrbL Machinery gene
  MPF86_RS00730 (MPF86_00730) comB7 152460..152585 (+) 126 WP_075668089.1 comB7 lipoprotein Machinery gene
  MPF86_RS00735 (MPF86_00735) comB8 152582..153325 (+) 744 WP_245064538.1 virB8 family protein Machinery gene
  MPF86_RS00740 (MPF86_00740) comB9 153325..154290 (+) 966 WP_245064539.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPF86_RS00745 (MPF86_00745) comB10 154283..155419 (+) 1137 WP_245064540.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPF86_RS00750 (MPF86_00750) - 155489..156901 (+) 1413 WP_245064541.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4738.72 Da        Isoelectric Point: 9.3278

>NTDB_id=666688 MPF86_RS00730 WP_075668089.1 152460..152585(+) (comB7) [Helicobacter pylori strain Hpfe088]
MRIFSVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666688 MPF86_RS00730 WP_075668089.1 152460..152585(+) (comB7) [Helicobacter pylori strain Hpfe088]
ATGAGAATTTTTTCTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854