Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG63_RS00735 Genome accession   NZ_CP094082
Coordinates   150465..150590 (+) Length   41 a.a.
NCBI ID   WP_001217865.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe097     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 145465..155590
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG63_RS00710 (MPG63_00710) - 145518..147740 (+) 2223 WP_245047377.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG63_RS00715 (MPG63_00715) panD 147730..148080 (+) 351 WP_245047379.1 aspartate 1-decarboxylase -
  MPG63_RS00720 (MPG63_00720) - 148091..148384 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG63_RS00725 (MPG63_00725) - 148384..149379 (+) 996 WP_245048100.1 PDZ domain-containing protein -
  MPG63_RS00730 (MPG63_00730) comB6 149394..150449 (+) 1056 WP_245047381.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG63_RS00735 (MPG63_00735) comB7 150465..150590 (+) 126 WP_001217865.1 hypothetical protein Machinery gene
  MPG63_RS00740 (MPG63_00740) comB8 150587..151330 (+) 744 WP_000660533.1 virB8 family protein Machinery gene
  MPG63_RS00745 (MPG63_00745) comB9 151330..152292 (+) 963 WP_245047383.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG63_RS00750 (MPG63_00750) comB10 152285..153421 (+) 1137 WP_245047385.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG63_RS00755 (MPG63_00755) - 153487..154899 (+) 1413 WP_245047391.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4794.82 Da        Isoelectric Point: 9.3278

>NTDB_id=666558 MPG63_RS00735 WP_001217865.1 150465..150590(+) (comB7) [Helicobacter pylori strain Hpfe097]
MRIFFVIIGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666558 MPG63_RS00735 WP_001217865.1 150465..150590(+) (comB7) [Helicobacter pylori strain Hpfe097]
ATGAGAATTTTTTTTGTTATTATTGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829