Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG38_RS00860 Genome accession   NZ_CP094080
Coordinates   194698..194823 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe099     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 189698..199823
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG38_RS00835 (MPG38_00835) - 189758..191980 (+) 2223 WP_245101322.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG38_RS00840 (MPG38_00840) panD 191970..192320 (+) 351 WP_156608295.1 aspartate 1-decarboxylase -
  MPG38_RS00845 (MPG38_00845) - 192331..192624 (+) 294 WP_245101323.1 YbaB/EbfC family nucleoid-associated protein -
  MPG38_RS00850 (MPG38_00850) - 192624..193619 (+) 996 WP_245101628.1 PDZ domain-containing protein -
  MPG38_RS00855 (MPG38_00855) comB6 193627..194682 (+) 1056 WP_245101629.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG38_RS00860 (MPG38_00860) comB7 194698..194823 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG38_RS00865 (MPG38_00865) comB8 194820..195557 (+) 738 WP_220934235.1 virB8 family protein Machinery gene
  MPG38_RS00870 (MPG38_00870) comB9 195557..196522 (+) 966 WP_245101324.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG38_RS00875 (MPG38_00875) comB10 196515..197651 (+) 1137 WP_245011877.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG38_RS00880 (MPG38_00880) - 197721..199133 (+) 1413 WP_245101325.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=666537 MPG38_RS00860 WP_001217874.1 194698..194823(+) (comB7) [Helicobacter pylori strain Hpfe099]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666537 MPG38_RS00860 WP_001217874.1 194698..194823(+) (comB7) [Helicobacter pylori strain Hpfe099]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878