Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG12_RS00885 Genome accession   NZ_CP094062
Coordinates   192193..192318 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe118     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 187193..197318
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG12_RS00860 (MPG12_00860) - 187253..189475 (+) 2223 WP_245045998.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG12_RS00865 (MPG12_00865) panD 189465..189815 (+) 351 WP_000142210.1 aspartate 1-decarboxylase -
  MPG12_RS00870 (MPG12_00870) - 189826..190119 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG12_RS00875 (MPG12_00875) - 190119..191114 (+) 996 WP_245046000.1 PDZ domain-containing protein -
  MPG12_RS00880 (MPG12_00880) comB6 191122..192177 (+) 1056 WP_245046002.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG12_RS00885 (MPG12_00885) comB7 192193..192318 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG12_RS00890 (MPG12_00890) comB8 192315..193052 (+) 738 WP_245046003.1 virB8 family protein Machinery gene
  MPG12_RS00895 (MPG12_00895) comB9 193052..194017 (+) 966 WP_245046004.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG12_RS00900 (MPG12_00900) comB10 194010..195146 (+) 1137 WP_245046005.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG12_RS00905 (MPG12_00905) - 195216..196628 (+) 1413 WP_245046007.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=666262 MPG12_RS00885 WP_001217874.1 192193..192318(+) (comB7) [Helicobacter pylori strain Hpfe118]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666262 MPG12_RS00885 WP_001217874.1 192193..192318(+) (comB7) [Helicobacter pylori strain Hpfe118]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878