Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG39_RS00700 Genome accession   NZ_CP094059
Coordinates   145788..145913 (+) Length   41 a.a.
NCBI ID   WP_245080553.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe122     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 140788..150913
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG39_RS00675 (MPG39_00675) - 140848..143070 (+) 2223 WP_245080545.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG39_RS00680 (MPG39_00680) panD 143060..143410 (+) 351 WP_245080548.1 aspartate 1-decarboxylase -
  MPG39_RS00685 (MPG39_00685) - 143421..143714 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG39_RS00690 (MPG39_00690) - 143714..144709 (+) 996 WP_245080551.1 PDZ domain-containing protein -
  MPG39_RS00695 (MPG39_00695) comB6 144717..145772 (+) 1056 WP_180608952.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG39_RS00700 (MPG39_00700) comB7 145788..145913 (+) 126 WP_245080553.1 comB7 lipoprotein Machinery gene
  MPG39_RS00705 (MPG39_00705) comB8 145910..146653 (+) 744 WP_000660545.1 virB8 family protein Machinery gene
  MPG39_RS00710 (MPG39_00710) comB9 146653..147615 (+) 963 WP_245080556.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG39_RS00715 (MPG39_00715) comB10 147608..148744 (+) 1137 WP_245080558.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG39_RS00720 (MPG39_00720) - 148814..150229 (+) 1416 WP_245080560.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4736.75 Da        Isoelectric Point: 9.3278

>NTDB_id=666218 MPG39_RS00700 WP_245080553.1 145788..145913(+) (comB7) [Helicobacter pylori strain Hpfe122]
MRIFSIIMGLILFGCTSKVHEMKKSPCALHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666218 MPG39_RS00700 WP_245080553.1 145788..145913(+) (comB7) [Helicobacter pylori strain Hpfe122]
ATGAGAATTTTTTCTATCATTATGGGACTAATATTATTTGGTTGCACGAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
TGCATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

78.049

100

0.78