Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MK860_RS15145 Genome accession   NZ_CP092829
Coordinates   2950942..2951082 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain MS32     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2945942..2956082
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MK860_RS15120 (MK860_15060) - 2946283..2946672 (-) 390 WP_106066313.1 hotdog fold thioesterase -
  MK860_RS15125 (MK860_15065) comA 2946696..2947337 (-) 642 WP_058013793.1 response regulator transcription factor Regulator
  MK860_RS15130 (MK860_15070) comP 2947418..2949703 (-) 2286 WP_278176354.1 ATP-binding protein Regulator
  MK860_RS15135 (MK860_15075) comX 2949710..2949889 (-) 180 WP_034620107.1 competence pheromone ComX -
  MK860_RS15140 (MK860_15080) - 2949867..2950790 (-) 924 WP_278176358.1 polyprenyl synthetase family protein -
  MK860_RS15145 (MK860_15085) degQ 2950942..2951082 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MK860_RS15150 (MK860_15090) - 2951588..2951941 (+) 354 WP_185106862.1 inner spore coat protein -
  MK860_RS15155 (MK860_15095) - 2951972..2953198 (-) 1227 WP_106066310.1 HDOD domain-containing protein -
  MK860_RS15160 (MK860_15100) - 2953340..2954809 (-) 1470 WP_058013789.1 nicotinate phosphoribosyltransferase -
  MK860_RS15165 (MK860_15105) - 2954827..2955378 (-) 552 WP_012011112.1 isochorismatase family cysteine hydrolase -
  MK860_RS15170 (MK860_15110) - 2955439..2955846 (-) 408 WP_044140823.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=660613 MK860_RS15145 WP_003213123.1 2950942..2951082(-) (degQ) [Bacillus pumilus strain MS32]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=660613 MK860_RS15145 WP_003213123.1 2950942..2951082(-) (degQ) [Bacillus pumilus strain MS32]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696