Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MKS87_RS17105 Genome accession   NZ_CP092631
Coordinates   3258820..3258960 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain YB-15     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3253820..3263960
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKS87_RS17080 (MKS87_17080) yuxO 3254134..3254514 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  MKS87_RS17085 (MKS87_17085) comA 3254533..3255177 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MKS87_RS17090 (MKS87_17090) comP 3255258..3257566 (-) 2309 Protein_3310 two-component system sensor histidine kinase ComP -
  MKS87_RS17095 (MKS87_17095) comX 3257581..3257748 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  MKS87_RS17100 (MKS87_17100) comQ 3257736..3258635 (-) 900 WP_173614277.1 ComX modifying isoprenyl transferase ComQ Regulator
  MKS87_RS17105 (MKS87_17105) degQ 3258820..3258960 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MKS87_RS17110 (MKS87_17110) - 3259182..3259307 (+) 126 WP_003228793.1 hypothetical protein -
  MKS87_RS17115 (MKS87_17115) - 3259421..3259789 (+) 369 WP_014477834.1 hypothetical protein -
  MKS87_RS17120 (MKS87_17120) pdeH 3259765..3260994 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  MKS87_RS17125 (MKS87_17125) pncB 3261131..3262603 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MKS87_RS17130 (MKS87_17130) pncA 3262619..3263170 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  MKS87_RS17135 (MKS87_17135) yueI 3263267..3263665 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=659382 MKS87_RS17105 WP_003220708.1 3258820..3258960(-) (degQ) [Bacillus subtilis strain YB-15]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=659382 MKS87_RS17105 WP_003220708.1 3258820..3258960(-) (degQ) [Bacillus subtilis strain YB-15]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1