Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   MKS87_RS17095 Genome accession   NZ_CP092631
Coordinates   3257581..3257748 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain YB-15     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3252581..3262748
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKS87_RS17065 (MKS87_17065) mrpE 3252975..3253451 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  MKS87_RS17070 (MKS87_17070) mrpF 3253451..3253735 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  MKS87_RS17075 (MKS87_17075) mnhG 3253719..3254093 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  MKS87_RS17080 (MKS87_17080) yuxO 3254134..3254514 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  MKS87_RS17085 (MKS87_17085) comA 3254533..3255177 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MKS87_RS17090 (MKS87_17090) comP 3255258..3257566 (-) 2309 Protein_3310 two-component system sensor histidine kinase ComP -
  MKS87_RS17095 (MKS87_17095) comX 3257581..3257748 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  MKS87_RS17100 (MKS87_17100) comQ 3257736..3258635 (-) 900 WP_173614277.1 ComX modifying isoprenyl transferase ComQ Regulator
  MKS87_RS17105 (MKS87_17105) degQ 3258820..3258960 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MKS87_RS17110 (MKS87_17110) - 3259182..3259307 (+) 126 WP_003228793.1 hypothetical protein -
  MKS87_RS17115 (MKS87_17115) - 3259421..3259789 (+) 369 WP_014477834.1 hypothetical protein -
  MKS87_RS17120 (MKS87_17120) pdeH 3259765..3260994 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  MKS87_RS17125 (MKS87_17125) pncB 3261131..3262603 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=659380 MKS87_RS17095 WP_003242801.1 3257581..3257748(-) (comX) [Bacillus subtilis strain YB-15]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=659380 MKS87_RS17095 WP_003242801.1 3257581..3257748(-) (comX) [Bacillus subtilis strain YB-15]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1