Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   MJ920_RS12140 Genome accession   NZ_CP092499
Coordinates   2505111..2505425 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain YC_89     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2500111..2510425
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MJ920_RS12095 (MJ920_12090) sinI 2500794..2500967 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  MJ920_RS12100 (MJ920_12095) sinR 2501001..2501336 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MJ920_RS12105 (MJ920_12100) - 2501384..2502169 (-) 786 WP_003153102.1 TasA family protein -
  MJ920_RS12110 (MJ920_12105) - 2502233..2502817 (-) 585 WP_012117977.1 signal peptidase I -
  MJ920_RS12115 (MJ920_12110) tapA 2502789..2503460 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  MJ920_RS12120 (MJ920_12115) - 2503719..2504048 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  MJ920_RS12125 (MJ920_12120) - 2504088..2504267 (-) 180 WP_003153093.1 YqzE family protein -
  MJ920_RS12130 (MJ920_12125) comGG 2504324..2504701 (-) 378 WP_043867284.1 competence type IV pilus minor pilin ComGG Machinery gene
  MJ920_RS12135 (MJ920_12130) comGF 2504702..2505202 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  MJ920_RS12140 (MJ920_12135) comGE 2505111..2505425 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  MJ920_RS12145 (MJ920_12140) comGD 2505409..2505846 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  MJ920_RS12150 (MJ920_12145) comGC 2505836..2506144 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  MJ920_RS12155 (MJ920_12150) comGB 2506149..2507186 (-) 1038 WP_043867286.1 competence type IV pilus assembly protein ComGB Machinery gene
  MJ920_RS12160 (MJ920_12155) comGA 2507173..2508243 (-) 1071 WP_043867287.1 competence type IV pilus ATPase ComGA Machinery gene
  MJ920_RS12165 (MJ920_12160) - 2508441..2509391 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=658187 MJ920_RS12140 WP_015388003.1 2505111..2505425(-) (comGE) [Bacillus velezensis strain YC_89]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=658187 MJ920_RS12140 WP_015388003.1 2505111..2505425(-) (comGE) [Bacillus velezensis strain YC_89]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481