Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MJ920_RS12095 Genome accession   NZ_CP092499
Coordinates   2500794..2500967 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain YC_89     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2495794..2505967
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MJ920_RS12080 (MJ920_12075) gcvT 2496612..2497712 (-) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -
  MJ920_RS12085 (MJ920_12080) - 2498135..2499805 (+) 1671 WP_003153107.1 SNF2-related protein -
  MJ920_RS12090 (MJ920_12085) - 2499823..2500617 (+) 795 WP_014305407.1 YqhG family protein -
  MJ920_RS12095 (MJ920_12090) sinI 2500794..2500967 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  MJ920_RS12100 (MJ920_12095) sinR 2501001..2501336 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MJ920_RS12105 (MJ920_12100) - 2501384..2502169 (-) 786 WP_003153102.1 TasA family protein -
  MJ920_RS12110 (MJ920_12105) - 2502233..2502817 (-) 585 WP_012117977.1 signal peptidase I -
  MJ920_RS12115 (MJ920_12110) tapA 2502789..2503460 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  MJ920_RS12120 (MJ920_12115) - 2503719..2504048 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  MJ920_RS12125 (MJ920_12120) - 2504088..2504267 (-) 180 WP_003153093.1 YqzE family protein -
  MJ920_RS12130 (MJ920_12125) comGG 2504324..2504701 (-) 378 WP_043867284.1 competence type IV pilus minor pilin ComGG Machinery gene
  MJ920_RS12135 (MJ920_12130) comGF 2504702..2505202 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  MJ920_RS12140 (MJ920_12135) comGE 2505111..2505425 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  MJ920_RS12145 (MJ920_12140) comGD 2505409..2505846 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=658184 MJ920_RS12095 WP_003153105.1 2500794..2500967(+) (sinI) [Bacillus velezensis strain YC_89]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=658184 MJ920_RS12095 WP_003153105.1 2500794..2500967(+) (sinI) [Bacillus velezensis strain YC_89]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGTCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702