Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | MJ920_RS12095 | Genome accession | NZ_CP092499 |
| Coordinates | 2500794..2500967 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain YC_89 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2495794..2505967
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MJ920_RS12080 (MJ920_12075) | gcvT | 2496612..2497712 (-) | 1101 | WP_014305405.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| MJ920_RS12085 (MJ920_12080) | - | 2498135..2499805 (+) | 1671 | WP_003153107.1 | SNF2-related protein | - |
| MJ920_RS12090 (MJ920_12085) | - | 2499823..2500617 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| MJ920_RS12095 (MJ920_12090) | sinI | 2500794..2500967 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| MJ920_RS12100 (MJ920_12095) | sinR | 2501001..2501336 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| MJ920_RS12105 (MJ920_12100) | - | 2501384..2502169 (-) | 786 | WP_003153102.1 | TasA family protein | - |
| MJ920_RS12110 (MJ920_12105) | - | 2502233..2502817 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| MJ920_RS12115 (MJ920_12110) | tapA | 2502789..2503460 (-) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| MJ920_RS12120 (MJ920_12115) | - | 2503719..2504048 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| MJ920_RS12125 (MJ920_12120) | - | 2504088..2504267 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| MJ920_RS12130 (MJ920_12125) | comGG | 2504324..2504701 (-) | 378 | WP_043867284.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| MJ920_RS12135 (MJ920_12130) | comGF | 2504702..2505202 (-) | 501 | WP_226565836.1 | competence type IV pilus minor pilin ComGF | - |
| MJ920_RS12140 (MJ920_12135) | comGE | 2505111..2505425 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| MJ920_RS12145 (MJ920_12140) | comGD | 2505409..2505846 (-) | 438 | WP_043867285.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=658184 MJ920_RS12095 WP_003153105.1 2500794..2500967(+) (sinI) [Bacillus velezensis strain YC_89]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=658184 MJ920_RS12095 WP_003153105.1 2500794..2500967(+) (sinI) [Bacillus velezensis strain YC_89]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGTCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGTCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |