Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   MG974_RS11710 Genome accession   NZ_CP092439
Coordinates   2431046..2431423 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain 504     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2426046..2436423
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MG974_RS11670 (MG974_11670) - 2426544..2427338 (+) 795 WP_003153106.1 YqhG family protein -
  MG974_RS11675 (MG974_11675) sinI 2427515..2427688 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  MG974_RS11680 (MG974_11680) sinR 2427722..2428057 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MG974_RS11685 (MG974_11685) tasA 2428105..2428890 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  MG974_RS11690 (MG974_11690) sipW 2428954..2429538 (-) 585 WP_012117977.1 signal peptidase I SipW -
  MG974_RS11695 (MG974_11695) tapA 2429510..2430181 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  MG974_RS11700 (MG974_11700) - 2430441..2430770 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  MG974_RS11705 (MG974_11705) - 2430810..2430989 (-) 180 WP_003153093.1 YqzE family protein -
  MG974_RS11710 (MG974_11710) comGG 2431046..2431423 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  MG974_RS11715 (MG974_11715) comGF 2431424..2431924 (-) 501 WP_224979425.1 competence type IV pilus minor pilin ComGF -
  MG974_RS11720 (MG974_11720) comGE 2431833..2432147 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  MG974_RS11725 (MG974_11725) comGD 2432131..2432568 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  MG974_RS11730 (MG974_11730) comGC 2432558..2432866 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  MG974_RS11735 (MG974_11735) comGB 2432871..2433908 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  MG974_RS11740 (MG974_11740) comGA 2433895..2434965 (-) 1071 WP_044053465.1 competence type IV pilus ATPase ComGA Machinery gene
  MG974_RS11745 (MG974_11745) - 2435157..2436107 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=657441 MG974_RS11710 WP_014305410.1 2431046..2431423(-) (comGG) [Bacillus velezensis strain 504]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=657441 MG974_RS11710 WP_014305410.1 2431046..2431423(-) (comGG) [Bacillus velezensis strain 504]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512