Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MG974_RS11675 Genome accession   NZ_CP092439
Coordinates   2427515..2427688 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain 504     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2422515..2432688
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MG974_RS11660 (MG974_11660) gcvT 2423333..2424433 (-) 1101 WP_044053463.1 glycine cleavage system aminomethyltransferase GcvT -
  MG974_RS11665 (MG974_11665) - 2424856..2426526 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  MG974_RS11670 (MG974_11670) - 2426544..2427338 (+) 795 WP_003153106.1 YqhG family protein -
  MG974_RS11675 (MG974_11675) sinI 2427515..2427688 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  MG974_RS11680 (MG974_11680) sinR 2427722..2428057 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MG974_RS11685 (MG974_11685) tasA 2428105..2428890 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  MG974_RS11690 (MG974_11690) sipW 2428954..2429538 (-) 585 WP_012117977.1 signal peptidase I SipW -
  MG974_RS11695 (MG974_11695) tapA 2429510..2430181 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  MG974_RS11700 (MG974_11700) - 2430441..2430770 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  MG974_RS11705 (MG974_11705) - 2430810..2430989 (-) 180 WP_003153093.1 YqzE family protein -
  MG974_RS11710 (MG974_11710) comGG 2431046..2431423 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  MG974_RS11715 (MG974_11715) comGF 2431424..2431924 (-) 501 WP_224979425.1 competence type IV pilus minor pilin ComGF -
  MG974_RS11720 (MG974_11720) comGE 2431833..2432147 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  MG974_RS11725 (MG974_11725) comGD 2432131..2432568 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=657439 MG974_RS11675 WP_003153105.1 2427515..2427688(+) (sinI) [Bacillus velezensis strain 504]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=657439 MG974_RS11675 WP_003153105.1 2427515..2427688(+) (sinI) [Bacillus velezensis strain 504]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702