Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   MID01_RS12990 Genome accession   NZ_CP092369
Coordinates   2508324..2508707 (-) Length   127 a.a.
NCBI ID   WP_041850015.1    Uniprot ID   -
Organism   Bacillus subtilis strain ZW     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2503324..2513707
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MID01_RS12950 (MID01_12950) sinI 2504258..2504431 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MID01_RS12955 (MID01_12955) sinR 2504465..2504800 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MID01_RS12960 (MID01_12960) tasA 2504893..2505678 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  MID01_RS12965 (MID01_12965) sipW 2505742..2506314 (-) 573 WP_003246088.1 signal peptidase I -
  MID01_RS12970 (MID01_12970) tapA 2506298..2507059 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  MID01_RS12975 (MID01_12975) yqzG 2507331..2507657 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MID01_RS12980 (MID01_12980) spoIIT 2507699..2507878 (-) 180 WP_003230176.1 YqzE family protein -
  MID01_RS12985 (MID01_12985) comGG 2507949..2508323 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  MID01_RS12990 (MID01_12990) comGF 2508324..2508707 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  MID01_RS12995 (MID01_12995) comGE 2508733..2509080 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  MID01_RS13000 (MID01_13000) comGD 2509064..2509495 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  MID01_RS13005 (MID01_13005) comGC 2509485..2509781 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  MID01_RS13010 (MID01_13010) comGB 2509795..2510832 (-) 1038 WP_041850016.1 comG operon protein ComGB Machinery gene
  MID01_RS13015 (MID01_13015) comGA 2510819..2511889 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  MID01_RS13020 (MID01_13020) corA 2512300..2513253 (-) 954 WP_029317911.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14250.41 Da        Isoelectric Point: 6.4838

>NTDB_id=656855 MID01_RS12990 WP_041850015.1 2508324..2508707(-) (comGF) [Bacillus subtilis strain ZW]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=656855 MID01_RS12990 WP_041850015.1 2508324..2508707(-) (comGF) [Bacillus subtilis strain ZW]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984